KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0138Help
Entry
Psesu_0138        CDS       T01403                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00620  Pyruvate metabolism
psu00630  Glyoxylate and dicarboxylate metabolism
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01200  Carbon metabolism
Module
psu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psesu_0138
   00630 Glyoxylate and dicarboxylate metabolism
    Psesu_0138
Enzymes [BR:psu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psesu_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADV26000
UniProt: E6WPP5
Position
156001..157689
Genome map
AA seq 562 aa AA seqDB search
MSAAAESAIPASPAPGPRPIPAVVPKGAAGLSLTERVAGQEQLLPAPLLGLLVTLHRAIE
PERRALLAARRERQAFYDAGGLPDFRDDTRAIREGDWKVAPIPQALQDRRVEITGPVDPK
MVINALNSGAHCYMADFEDSTAPTWRNLLAGQGALAGAVEGSLAFEAGNGKQYRLRPYEE
RAVLIVRPRGWHLDEKHVRVDGEPIAGGLFDMAVFAYHNARTLMANDRGPYFYLPKLQSM
EEAALWETALSHVEAFLGLPHGQMKATVLVETLPAVFEMDEILHALRDRIVGLNCGRWDY
IFSYLKTFRAHADKVLPERGQVTMTQPFLKAYSELLIRTCHRRGAHAMGGMAAQIPNASD
PVANEQALARVRADKLREVTAGHDGTWVAHPALIPVAREMFDAHMPTPNQHHVLREDVQV
SRDDLIRPCEGTITREGFENNVEVCVRYLAAWLDGNGCVPIHGMMEDAATAEIARAQLWQ
WLHHSDPRGRHADGSPVHLADGTVVDFALFERTLAALPGRLGDTAGLPGGNRIAEATALL
DELTRACQLVEFLTLPAYARLD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgccgaaagtgccattcccgcctctcccgccccgggcccgcgcccgatc
ccggccgtcgtccccaagggcgccgccgggctttcgctgaccgagcgggtcgcaggccag
gaacagctgcttccggcgccgctgctgggcctgctggtgacgctgcaccgggcgatcgag
ccggagcgccgcgccctgctcgccgctcgccgcgagcgccaggcgttctacgacgccggc
ggcctgcctgacttccgcgacgacacccgcgccatccgcgagggcgactggaaggtcgcg
ccgatcccgcaggcgctgcaggaccgccgggtggagatcactggcccggtcgacccgaag
atggtgatcaacgcgctgaactccggcgcgcactgctacatggccgacttcgaggattcg
accgcaccgacctggcgcaacctgctggccggccagggcgccctggccggcgcggtggaa
ggctcgctggccttcgaggccgggaacggcaagcagtaccgcctgcgtccgtacgaggag
cgagccgtgctgatcgtgcgtccgcgcggctggcacctggacgagaagcacgtgcgcgtg
gacggcgagccgatcgccggcggcctgttcgacatggcggtgttcgcgtaccacaacgcc
cgcaccctgatggccaacgaccgcgggccgtacttctacctgcccaagctgcagtcgatg
gaggaagcggcgctgtgggagaccgcgctgtcccacgtcgaggccttcctgggcctgccg
cacgggcagatgaaggccaccgtcctggtcgagaccctgccggcggtgttcgagatggac
gagatcctgcacgcgctgcgcgaccggatcgtcggcctgaactgcgggcgctgggactac
atcttctcgtacctgaagaccttccgcgcccatgccgacaaggtgttgccggagcgtggc
caggtgaccatgacccagccgttcctgaaggcgtattcggaactgctgatccgcacctgc
caccgccgcggcgcccacgccatgggcggcatggcggcgcagatccccaatgcctccgac
ccggtggccaacgagcaggcgctggcccgcgtgcgcgccgacaagctgcgcgaggtcacc
gccggccacgacggcacctgggtcgcgcatccggcgctgatcccggtggcgcgcgagatg
ttcgacgcgcacatgccgaccccgaaccagcaccacgtgctgcgcgaggacgtgcaggtc
agccgcgacgacctgatccgtccgtgcgagggcacgatcacccgcgagggcttcgagaac
aacgtcgaggtctgcgtgcgctacctggccgcatggctggacggcaacggctgcgtcccg
atccacgggatgatggaggacgcggccaccgccgagatcgcccgcgcccagctgtggcaa
tggctgcaccactccgatccgcgcggccgccacgccgacggcagcccggtgcacctggcc
gacggcacggtggtcgacttcgccctgttcgaacgcaccctggccgcgctgcccgggcgc
ctgggcgacaccgccggcctgcctggcggcaaccgcatcgccgaggcgaccgcgctgctg
gacgagctgacccgcgcctgccagctggtcgagttcctgaccctgcccgcctacgcccgc
ctcgactga

DBGET integrated database retrieval system