KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0139Help
Entry
Psesu_0139        CDS       T01403                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00630  Glyoxylate and dicarboxylate metabolism
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01200  Carbon metabolism
Module
psu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psesu_0139
Enzymes [BR:psu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Psesu_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADV26001
UniProt: E6WPP6
Position
157852..159144
Genome map
AA seq 430 aa AA seqDB search
MSTLKTAEQIQHEWNTDPRWAGITRNYTAEDVVRLRGTIPVDHSIARITSGKLWNYLQDL
DFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVKR
INNTLLRADQLHHAEGNDSIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAVEKLNAARLAADVMGVPTILIARTDAEAADLLTSDIDDN
DKPFCTGERTVEGFYRVRNGLEQSISRGLAYAPYADLVWCETGKPDLEFARRFAEAIHAR
YPGKMLAYNCSPSFNWKKNLDDATIAKFQKEIASYGYKFQFITLAGFHALNYSMFNLAHG
YARNQMSAFVELQEAEFAAAGKGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALKGSTE
EEQFHDRSAA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgctgaagaccgccgagcagatccagcacgaatggaacaccgacccgcgctgg
gccggcatcacccgcaactacaccgccgaggacgtggtccgcctgcgcggcaccatcccg
gtcgaccactccattgcccgcatcacctccggcaagctgtggaactacctgcaggacctg
gacttcgtcaacgcgctgggcgcgctgaccggcaaccaggccatgcagcaggtcaaggcg
gggctcaaggcgatctacctgagcggctggcaggtggcggccgacgccaacctggccggg
cagatgtatcccgaccagtcgctgtacccggccgattcggtgccggccgtggtcaagcgc
atcaacaacaccctgttgcgcgccgaccagctgcaccacgccgagggcaacgacagcatc
gacttcctgcagccgatcgtggccgatgccgaggccggcttcggcggcgtgctcaacgcg
ttcgagctgatgaaggcgatgatcgaggccggcgccgcgggcgtgcacttcgaggaccag
ctggcctcggtgaagaagtgcggccacatgggcggcaaggtcctggtgccgacccgcgag
gcggtggagaagctcaacgccgcgcgcctggccgccgacgtcatgggcgtaccaaccatc
ctgatcgcgcgcaccgatgccgaggccgccgacctgctgacctcggacatcgacgacaac
gacaagccgttctgcaccggcgagcgcaccgtcgagggcttctaccgggtcaggaacggc
ctggagcagtcgatcagccgcggcctggcctacgcgccttacgccgacctggtctggtgc
gagaccggcaagccggacctggagttcgcgcgcaggttcgccgaggccatccacgccagg
tacccgggcaagatgctggcctacaactgctcgccgagcttcaactggaagaagaacctg
gacgacgccacgatcgcgaagttccagaaggagatcgccagctacggctacaagttccag
ttcatcaccctggccggcttccacgccctgaactactcgatgttcaacctggcccacggc
tatgcccgcaaccagatgagcgccttcgtcgagctgcaggaagcggagttcgccgccgcc
ggcaagggcttcaccgcggtcaagcaccagcgcgaggtcggtaccggctatttcgacgcg
gtgacccaggcgatccagcagggccagtcctcgaccacggcgctgaagggttcgaccgag
gaagagcagttccacgaccgcagcgccgcctga

DBGET integrated database retrieval system