KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0211Help
Entry
Psesu_0211        CDS       T01403                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00520  Amino sugar and nucleotide sugar metabolism
psu01100  Metabolic pathways
psu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_0211
Enzymes [BR:psu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Psesu_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ADV26073
UniProt: E6WPA0
Position
235685..236836
Genome map
AA seq 383 aa AA seqDB search
MASQALVNGRVLLDDGFHDDVAVLLDGSGRIQALVPEGQARIEAGKVRDLGGGWLLPGFI
DVQVNGGGGVLFNNDTSPGAIDTIGRAHRRYGTTSFLPTLISDTAEVMERAIAGTREAIA
AGVPGVLGVHLEGPYLAPARKGTHDAARFRVPDAAEVAMATSLDNGVTLVTLAPEQVPAD
TIRAMVTRGAIVCAGHTAGTYEQIRAGLEAGVRGFTHLYNAMSPLQGREPGAVGAALESR
EAYCGIIVDGVHVHPASLRVALAAKPRGTLFLVTDAMPMVGSDDPSFELYGETITAVDGV
VRNAAGALAGSALDMATAVRNTVRLLGLPLEEAARMASTYPARFLGVDSRLGRIAPGWQA
DLVLLDEALQVQATWVAGAASDS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggccagccaggccctggtgaacggccgcgtcctgctggacgacggcttccatgacgac
gtggcggtgctgctggatggtagcggccgcatccaggcgctggtgcccgagggccaggcg
cggatcgaggccggcaaggtgcgggacctcggcggcggctggctgctgcccggcttcatc
gacgtgcaggtcaacggcggcggcggggtgctgttcaacaacgacaccagccccggagcg
atcgacaccatcggccgagcgcaccgccgttacgggacgaccagcttcctgccgaccctg
atcagcgacaccgccgaggtgatggagcgcgccatcgccggcacccgggaggcgatcgcc
gccggcgtgcccggtgtgctgggcgtgcacctggaaggcccctatctggcgccagcgcgc
aagggcacgcacgatgcggcgcgcttccgcgtgccggatgcggcggaagtggcgatggcc
acctcgctcgacaacggcgtcaccctggtcacgcttgcgcccgagcaggtgccggccgac
acgatccgggcgatggtcacgcgaggcgccatcgtctgcgccggacacaccgccggcacc
tacgagcagatccgtgccggcctggaagccggcgtgcgcggcttcacccacctctacaac
gccatgtcgccgctgcagggacgcgagcccggtgcggtcggtgccgcgctggaaagccgc
gaggcgtactgcgggatcatcgtcgacggcgtgcacgtgcatccggccagtctgcgggtg
gcgctggcggccaagccgcgcggcaccctgttcctggtcaccgatgcgatgccgatggtc
ggctccgacgatccctcgttcgagctttacggcgagaccatcaccgcggtggacggggtg
gtgcgcaatgccgccggcgcgctcgcaggctctgccctggacatggcgaccgcggtgcgc
aacacggtgcggctgctgggcctgccgctggaggaggcggcacgcatggcctccacctat
ccggcgcgtttccttggcgtggattcgcgcctgggccggatcgcgccgggctggcaggcc
gacctggtgctgctggacgaggcgctgcaggtgcaggcgacctgggtcgccggcgcggct
tcggactcctga

DBGET integrated database retrieval system