KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0551Help
Entry
Psesu_0551        CDS       T01403                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Brite
KEGG Orthology (KO) [BR:psu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Psesu_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: ADV26409
UniProt: E6WQG0
Position
complement(607538..607927)
Genome map
AA seq 129 aa AA seqDB search
MSRSCSTPYAIEVEVDPRFLEDQSEPEADRYVFAYTIRIRNRGSVAAQLLARHWVITDGH
GRTEEVHGEGVVGEQPWLEPGEDFEYTSGVVLETGDGSMQGSYDMVAADGTRFDAPIAPF
LLTTPRTLH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctcctgctccacgccatacgcgatcgaggtcgaagtcgacccgcggttcctg
gaagaccagtccgaacccgaggccgaccgctacgtgttcgcctacaccatccggatccgc
aaccgcggcagcgttgcagcgcagctgctcgcgcgccactgggtcatcaccgatggccac
ggccggaccgaggaagtgcacggcgaaggcgtggtcggcgagcagccatggctggaaccg
ggcgaggacttcgaatacacctccggcgtggtgctggagaccggggacggctcgatgcag
ggcagctacgacatggtggccgccgatggcacccgcttcgatgcgccgatcgccccgttc
ctgctgaccaccccacggaccctgcactga

DBGET integrated database retrieval system