KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0901Help
Entry
Psesu_0901        CDS       T01403                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00900  Terpenoid backbone biosynthesis
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psesu_0901
Enzymes [BR:psu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Psesu_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADV26752
UniProt: E6WRM1
Position
complement(1010453..1011679)
Genome map
AA seq 408 aa AA seqDB search
MSSPADIRRVAVLGATGSIGTSALDVIARHPQRMRATVLAAGGRVDALLQLCVAHRPEHA
VIADPALYPRLRDGLREAGLDTRAHAGDEALQALAAGPDCDTVVAAIVGAAGLGSTLAAA
RAGKRLLLANKESLVLAGELVMAAVREAGAEIVPIDSEHSAVFQCLRSCRDTGVRRIVLT
ASGGPFRGRSHASLAEVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGS
RIDVLVHPQSLVHALVEYVDGSTLAQLGLPDMRTALAVGLGWPERIESGVAGLDLLSQGR
LEFEAPDMDAFPCLGLARGAMEAGGTAPAVLNAANEEAVSAFLQGRVGFLAIPALVEDAL
AALPAAPATSLEALLQADADARRVTRQMIEHRSPGGAPATPPQDARHG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccccgccgacatccgccgggtcgcggtcctcggagccaccggctccatcggc
acctccgcgctcgatgtcatcgcccgccatccgcagcgcatgcgtgccaccgtcctcgca
gccggcggccgggtcgatgccctgctgcagctgtgcgtcgcgcaccgccccgaacacgcg
gtgatcgccgacccggccctgtacccgcgcctgcgcgacgggctgcgcgaggccggcctg
gatacccgcgcccatgccggcgacgaggccctgcaggcgctggccgccgggcccgactgc
gacaccgtggtcgccgccatcgtcggtgccgccggactgggctcgaccctggccgcggcc
cgcgccggcaagcgcctgctgctggccaacaaggaatccctggtcctggccggcgagctg
gtcatggccgccgtccgcgaggccggcgccgagatcgtgccgatcgacagcgaacacagc
gcggtgttccagtgcctgcgctcctgccgcgacaccggcgtgcgccggatcgtgctgacc
gcctccggcggcccgttccgcggtcgcagccatgcctcgctggccgaggtcaccccggcc
caggccgtggcccatcccaagtggtcgatggggccgaagatctcggtcgactcggccacc
ctgatgaacaagggcctggaagtgatcgaggcccaccatctgttcggcctgcccgggtcg
cggatcgacgtgctggtccacccgcagagcctggtccatgccctggtcgaatacgtggac
ggctccaccctcgcccagctcggcctgccggacatgcgcacggcgctggcagttggcctg
ggctggccggaacggatcgaatccggcgtggccgggctggacctgctcagccagggccgg
ctggagttcgaggcgccggacatggacgccttcccctgcctgggcctggcccgcggggcg
atggaagccggcggaaccgcccccgcggtgctcaacgccgccaacgaggaggcggtttca
gcctttcttcagggccgcgtgggtttcctagccattcccgcgctggtcgaggacgccctc
gccgcactgcccgccgcgcccgccacctccctggaggcgctgctgcaggccgacgcggat
gcacgccgagtgacccgccagatgatcgaacaccgttcccccggcggtgccccagccacg
ccgccccaggacgcccgccatgggtga

DBGET integrated database retrieval system