KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1253Help
Entry
Psesu_1253        CDS       T01403                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00072  Synthesis and degradation of ketone bodies
psu00650  Butanoate metabolism
psu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Psesu_1253
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Psesu_1253
Enzymes [BR:psu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Psesu_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADV27101
UniProt: E6WSF2
Position
complement(1376210..1376968)
Genome map
AA seq 252 aa AA seqDB search
MRNILITGAASGIGAGIARELAAAGHHLIVSDLSAEGAGTVAEGIRAAGGSAEAVALDVT
SDTSIAHALTSISCPVDVLVNNAGLQHVSPLEEFPLEKWDFLVQVMLVGVARLTRAVLPG
MRERGYGRIVNIGSIHALVASPYKSAYVAAKHGLVGFSKVVALETADTDITINTICPSYV
KTPLVDSQIAAQARTRGISEEEVVSQVMLKPMPKGVFIGMDELAGTTAFLLSPAARNLTG
QCLVLDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacatcctcatcaccggcgcggccagcggcatcggcgccggcatcgcccgcgaa
ctggccgccgcgggccaccacctgatcgtcagcgacctgtcggccgagggtgccggcacg
gtcgccgaagggatccgcgccgccggcggctcggccgaagcggtggccttggacgtgacc
tccgataccagcatcgcccatgcgctgacctcgatctcctgcccggtcgacgtgctggtc
aacaacgccggcctgcagcacgtctcgccgctggaggagttcccgctggagaagtgggac
ttcctggtccaggtgatgctggtcggcgtggcccgcctgacccgcgcggtgctgcctggc
atgcgcgagcgtggctacggccgcatcgtcaacatcggcagcatccatgccctggtcgcc
agcccgtacaagagtgcgtacgtggcggccaagcacggcctggtcggattctccaaggtg
gtggcgctggagacggcggatacggacatcaccatcaacaccatctgccccagctacgtg
aagaccccgctggtggacagccagatcgcggcccaggcccgcacccgcggcatttccgag
gaggaagtggtctcgcaggtgatgctcaagccgatgcccaagggtgtgttcatcggcatg
gacgaactggccggcaccaccgcgttcctgctctcgccggcggcgcgcaacctcaccggc
cagtgccttgtgctggacggcggctggaccgcgcagtaa

DBGET integrated database retrieval system