KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1291Help
Entry
Psesu_1291        CDS       T01403                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00010  Glycolysis / Gluconeogenesis
psu00052  Galactose metabolism
psu00500  Starch and sucrose metabolism
psu00520  Amino sugar and nucleotide sugar metabolism
psu00521  Streptomycin biosynthesis
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01130  Biosynthesis of antibiotics
psu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_1291
   00052 Galactose metabolism
    Psesu_1291
   00500 Starch and sucrose metabolism
    Psesu_1291
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_1291
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psesu_1291
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Psesu_1291
Enzymes [BR:psu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psesu_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADV27139
UniProt: E6WSY3
Position
complement(1415296..1416288)
Genome map
AA seq 330 aa AA seqDB search
MSDLFLIADIGGTNARFALADTSAQTPLLEDSVREFAVAEFPSLAEAARHYLDQAQASAR
CGVFAVAGRVDGDEARITNHPWVISRPRTREMLGFDQVYLINDFAAQAMAISLYRAEDVV
PIGGVPWTPAPAGEPRTYAVLGPGTGLGVGGLVVRDGRCYPLETEGGHVSFPPGTPEEIR
ILEILSAQFGRVSNERLICGPGLVNIHRALCEIAGHDPGLLEPKDVTARAAAGDPLCMRA
VDVFCAVFGAISGDLVLTIGAWDGVFLTGGLVPKMLDSLRHSGFRQRFEYKGRFSPTMAR
VPSLAVLHPQAGLLGAAAYAVDLVRREASA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgttcctgatcgccgacatcggcggcaccaacgcgcgcttcgcgctggcc
gacaccagcgcgcagacgccgctgctcgaggacagcgtgcgcgagttcgccgtcgccgag
ttcccgtcgctggccgaggccgcgcgccactacctcgaccaggcccaggccagcgcccgc
tgcggcgtgttcgccgtggccggccgcgtggacggcgacgaggcgcgcatcaccaaccat
ccgtgggtgatctcgcgtcctcgcacccgcgagatgctgggcttcgaccaggtctacctg
atcaacgacttcgccgcccaggccatggccatcagcctgtaccgggccgaggacgtggtg
ccgatcggcggcgtgccctggaccccggcgcccgccggcgagccgcgcacctatgccgtg
ctcggcccgggtaccggcctgggcgtgggcggcctggtggtgcgtgacggccgctgctat
ccgctggagaccgagggcggccacgtcagcttcccgcccggcacgccggaggagatccgc
atcctggagatcctgtcggcgcagttcggccgcgtctccaacgagcgcctgatctgcggc
ccgggcctggtgaacatccaccgcgccctgtgcgagatcgccggccacgaccccggcctg
ctcgagcccaaggacgtcaccgcccgcgccgccgccggcgatccgctgtgcatgcgcgcg
gtcgacgtgttctgcgcggtgttcggcgcgatctccggcgacctggtgctgaccatcggt
gcctgggacggcgtgttcctcaccggcggcctggtaccgaagatgctggattcgctgcgc
cactccggcttccgccagcgcttcgagtacaagggccgcttctcgccgaccatggcgcgg
gtgccctcgctcgccgtgctgcatccgcaggccgggctgctcggcgcggccgcctacgcg
gtggacctggtccgccgggaggcgtcggcgtga

DBGET integrated database retrieval system