KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1637Help
Entry
Psesu_1637        CDS       T01403                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00071  Fatty acid degradation
psu00072  Synthesis and degradation of ketone bodies
psu00280  Valine, leucine and isoleucine degradation
psu00310  Lysine degradation
psu00362  Benzoate degradation
psu00380  Tryptophan metabolism
psu00620  Pyruvate metabolism
psu00630  Glyoxylate and dicarboxylate metabolism
psu00640  Propanoate metabolism
psu00650  Butanoate metabolism
psu00900  Terpenoid backbone biosynthesis
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01130  Biosynthesis of antibiotics
psu01200  Carbon metabolism
psu01212  Fatty acid metabolism
psu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psesu_1637
   00630 Glyoxylate and dicarboxylate metabolism
    Psesu_1637
   00640 Propanoate metabolism
    Psesu_1637
   00650 Butanoate metabolism
    Psesu_1637
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Psesu_1637
   00072 Synthesis and degradation of ketone bodies
    Psesu_1637
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psesu_1637
   00310 Lysine degradation
    Psesu_1637
   00380 Tryptophan metabolism
    Psesu_1637
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psesu_1637
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psesu_1637
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Psesu_1637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psu04147]
    Psesu_1637
Enzymes [BR:psu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Psesu_1637
Exosome [BR:psu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psesu_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADV27479
UniProt: E6WTI0
Position
1810441..1811616
Genome map
AA seq 391 aa AA seqDB search
MSDIVIAAAKRTAIGSFLGQFNGVPTPTLGAAAIAAALEQSGVPASDVSEVIMGCVLPAN
LGQAPARQAALAAGLPTSAGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHMIPNSRTGNRYGGFQAVDHMAWDGLTNPYDGQSMGVFAEKTVEKYGFTREEQDAYAI
ESVNRAQAALANGAFEGEIVPVKVATRKGEVEVATDEQPGKSDVAKIPTLRPAFRKDGTV
TAASSSSISDGAAATVLLSAEEAARRGIQPLAKIVGHSTFSHQPEWFTTAPVGAISNLLD
KVGWSVGDVDLFEINEAFAVVAMAPIRDLGIPHEKINVNGGACALGHPIGATGARLVVTL
VNALRKRGLKKGVAALCIGGGEATAIALEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgccgccgccaaacgcactgccatcggctccttcctgggccag
ttcaatggcgtccccaccccgaccctcggtgctgccgcgatcgccgccgcgctggagcag
tccggcgtgcccgcgtccgacgtgtcggaggtgatcatgggctgcgtgctgccggccaac
ctcggccaggcccctgcacgccaggcggcgctggccgccggcctgccgacctcggccggc
gcgaccaccatcaacaaggtctgcggctcgggcatgaaggcgatcatgctgggccatgac
ctgatcaaggccggctcggcctcgatcgtggtcgccggcggcatggagtcgatgagcaac
gcgccgcacatgatccccaactcgcgcaccggcaaccgctacggcggcttccaggcggtc
gaccacatggcgtgggacggcctgaccaatccgtacgacggccagtcgatgggcgtgttc
gccgagaagacggtcgagaagtacggcttcacccgcgaggagcaggacgcctacgcgatc
gagtcggtgaaccgcgcccaggcggcgcttgccaatggtgcgttcgagggcgagatcgtc
ccggtcaaggtcgccacccgcaagggcgaggtcgaggtcgccaccgacgagcagccgggc
aagtccgacgtggccaagatcccgaccctgcgtccggcgttcaggaaggacggcacggtc
accgcggccagctcctcgtcgatctccgacggcgccgccgccaccgtgctgctgtcggcc
gaggaagccgcccgccgcgggatccagccgctggcgaagatcgtcggccactccaccttc
tcgcaccagccggagtggttcaccaccgccccggtgggcgcgatctccaacctgctggac
aaggtaggctggtcggtcggtgacgtggacctgttcgagatcaacgaggcgttcgccgtc
gtggccatggccccgatccgcgacctgggcattccgcacgagaagatcaacgtcaatggt
ggcgcctgcgccttgggtcatccgatcggcgcgaccggcgcgcggctggtcgtgaccctg
gtcaatgcactgcgcaagcgcggcctgaagaagggcgtggctgcgctgtgcatcggcgga
ggagaggctaccgctatcgctctggaaatgctgtaa

DBGET integrated database retrieval system