KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1935Help
Entry
Psesu_1935        CDS       T01403                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00260  Glycine, serine and threonine metabolism
psu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01130  Biosynthesis of antibiotics
psu01230  Biosynthesis of amino acids
Module
psu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psesu_1935
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psesu_1935
Enzymes [BR:psu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psesu_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADV27773
UniProt: E6WU53
Position
complement(2139691..2140905)
Genome map
AA seq 404 aa AA seqDB search
MTSSIQDFHAYPDTSGHFGQHGGRFVAETLMGPLQELAAAYDQARVDPAFIAAFDKDLKH
YVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKKRIIAET
GAGQHGVASATVATRLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDAL
NEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAVVGREARAQMLTDYGRLPDVITAC
VGGGSNAIGLFHAFLNDRDVRIVGAEAAGDGVATGRHAASLSAGRVGVLHGNRTYVLCDD
DGQIIETHSISAGLDYPGVGPEHSFLQDSGRAEYVGVTDEEALEAFHKLTRTEGILPALE
SSHAVAQAIKLARELPKDKLVLCNLSGRGDKDVHTIAAREGIQL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctccatccaggacttccacgcctatcccgacaccagcggccatttcggccag
cacggcggccgcttcgtcgccgagaccctgatggggccgctgcaggagctggccgcggcc
tatgaccaggcgcgggtcgatccggccttcatcgccgccttcgacaaggacctcaagcac
tacgtcggccggcccagcccgatctaccacgccgagcgcctgagccgggaagtgggcggt
gcgcagatcctgctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaacaac
accatcggccaggccctgctggccgcgcgcatgggcaagaagcggatcatcgccgagacc
ggcgccggccagcacggcgtggccagtgccaccgtcgccacccgcctcggcctggagtgc
gtggtctacatgggggccaccgacatcgagcggcagaagatcaacgtctaccggatgaag
ctgctgggcgcgaccgtggtcccggtgacctccggctcggccacgctcaaggacgcgctc
aacgaggccatgcgcgactgggtcaccaatgtccaggacaccttctacatcatcggaacc
gtcgccggtcccgatccgtacccgcggatggtgcgcgacttcaacgccgtggtcggccgc
gaggcgcgcgcgcagatgctcaccgactacggccgcctgccggacgtgatcaccgcctgc
gtcggcggcggcagcaatgccatcggcctgttccatgcgttcctcaacgacagggacgtg
cgcatcgtcggcgccgaggctgccggcgacggagtcgcgaccggtcgccatgcggcctcg
ctgtcggctggccgggtcggcgtgctgcacggcaaccgcacctacgtgctgtgcgacgac
gatggccagatcatcgagacccactcgatctccgccggcctggactacccgggcgtgggc
ccggagcactccttcctgcaggacagcggccgcgccgagtacgtgggcgtgaccgacgag
gaggcgctggaagccttccacaagctgacccgcaccgagggcatcctgccggcgctggaa
tccagccatgcggtcgcgcaggcgatcaagctggcgcgcgagctgccgaaggacaagctg
gtgctgtgcaacctctccggccgcggcgacaaggacgtgcacaccatcgccgcgcgcgag
ggcatccagctgtga

DBGET integrated database retrieval system