KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1994Help
Entry
Psesu_1994        CDS       T01403                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00071  Fatty acid degradation
psu00280  Valine, leucine and isoleucine degradation
psu00281  Geraniol degradation
psu00310  Lysine degradation
psu00362  Benzoate degradation
psu00380  Tryptophan metabolism
psu00410  beta-Alanine metabolism
psu00640  Propanoate metabolism
psu00650  Butanoate metabolism
psu00903  Limonene and pinene degradation
psu00930  Caprolactam degradation
psu01040  Biosynthesis of unsaturated fatty acids
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01130  Biosynthesis of antibiotics
psu01200  Carbon metabolism
psu01212  Fatty acid metabolism
Module
psu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psesu_1994
   00650 Butanoate metabolism
    Psesu_1994
  Lipid metabolism
   00071 Fatty acid degradation
    Psesu_1994
   01040 Biosynthesis of unsaturated fatty acids
    Psesu_1994
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psesu_1994
   00310 Lysine degradation
    Psesu_1994
   00380 Tryptophan metabolism
    Psesu_1994
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psesu_1994
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psesu_1994
   00281 Geraniol degradation
    Psesu_1994
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psesu_1994
   00930 Caprolactam degradation
    Psesu_1994
Enzymes [BR:psu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Psesu_1994
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psesu_1994
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Psesu_1994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 DAO AlaDh_PNT_C Pyr_redox_2 ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADV27831
UniProt: E6WUB1
Position
2203956..2206031
Genome map
AA seq 691 aa AA seqDB search
MLPGLDGLRFSHWQAARRDDGVVVLALDRSDAAVNALSQDVLIELGDIVERLAIDPPRGV
VFSSAKASGFIAGADLKEFQEFDRRGTVNDAIRRGQAVFQKVAELPCPTVAAIHGFCMGG
GTELALACDYRVASSDPSTRIGLPETQLGIFPGWGGSARLPRLVGAPAAMDMMLTGRRLA
AKAARNIGLVDKVVEPAVLEDTAAALALKGLERPFGQRFKGWATNTWLARKILAPQMAKQ
VARKAKKEHYPAPYALINTWARSGGAGIQARLDAERRAVVKLAASPTARNLIRIFFLSER
LKGLGGKDHGIAHVHVVGAGVMGGDIAAWAAYKGFTVTLQDREQRFIDGALARAQELFAK
RVKDDAKRPAVAARLQGDLAGDGVAKADLVIEAIIENPEAKRELYQSLEPRMKPDALLVT
NTSSIPLDELRGHIARPAQFAGLHYFNPVAQMPLVEIVRHAALDPATEQRLAAFCKALDK
FPVPVAGTPGFLVNRVLFPYMLEAAHAYAEGIPGAVIDKAAVKFGMPMGPIELIDTVGLD
VAQGVGAELSPFLGLQLPAALSTVEPGRRGKKDGQGLYTWQKTEKGSKPVKPEVPQGYKA
PEDLEDRLILPLLNEAVACLHDGVVDDADLLDAGVIFGTGFAPFRGGPIQHIRATGADVL
LEKLKTLQARHGERFAPRQGWDSALLRQPPV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgctcccaggtctcgacggactccgattcagccactggcaagccgccaggcgagacgac
ggagtcgtggtactggcgctggaccgctccgatgcggcggtcaacgcgctgtcgcaggac
gttctgatcgagctgggggacatcgtcgagcgcctagcgatcgacccgccccgcggcgtg
gtgttcagctcggccaaggccagcggcttcatcgccggcgccgacctgaaggagttccag
gaattcgaccgccgcggcacggtcaacgacgccatccgccgcggccaggcggtgttccag
aaggtggccgagctgccctgcccgaccgtggccgcgatccacggcttctgcatgggcggc
ggcaccgagctggccctggcctgcgactaccgcgtggccagcagcgacccgtccacccgc
atcggcctgccggaaacccagctgggcatcttccccggctggggcggcagcgcacgcctg
ccgcgcctggtcggcgccccggcggcgatggacatgatgctcaccggccgccgcctggcc
gcgaaggccgcacgcaacatcggcctggtcgacaaggtggtcgagccggccgtgctcgag
gacaccgccgcggcactggcgctgaagggcctggagcgtccgttcggccagcgcttcaag
ggctgggcgaccaacacctggctggcgcggaagatcctggcgccgcagatggccaagcag
gtcgcgcgcaaggcgaagaaggagcactaccctgccccgtacgcgctgatcaacacctgg
gcgcgcagcggcggcgccgggatccaggcccgcctggacgccgagcgccgcgcggtggtc
aagctggccgccagcccgactgcgcgcaacctgatccgcatcttcttcctcagcgagcgg
ctcaagggcctgggcggcaaggatcacggcatcgcccacgtgcacgtggtcggtgccggc
gtcatgggtggcgacatcgccgcctgggcggcctacaagggcttcaccgtcaccctgcag
gaccgcgagcagcgcttcatcgatggcgccctcgcacgcgcgcaggaactgttcgccaag
cgggtcaaggacgatgccaagcgcccggccgtggccgcgcgcctgcagggcgacctggcc
ggcgacggcgtggcgaaggccgacctggtgatcgaggcgatcatcgagaacccggaggcc
aagcgcgagctgtaccagtcgctggagccgcgcatgaagccggacgcgctgctggtcacc
aacacctcctcgatcccgctggacgagctgcgcggccacatcgcgcgcccggcgcagttc
gccggcctgcactacttcaatccggtggcgcagatgccgctggtggagatcgtgcgccac
gccgcgctggatccggccaccgagcagcgcctggcggcgttctgcaaggcactggacaag
ttcccggtgccggtcgccggcaccccgggcttcctggtcaaccgcgtgctgttcccgtac
atgctcgaggccgcgcacgcctacgccgagggcatccccggcgcggtgatcgacaaggcg
gcggtgaagttcggcatgcccatgggcccgatcgagctgatcgacaccgtgggcctggac
gtggcccagggcgtgggcgccgagctgtcgccgttcctgggcctgcagctgccggcggcg
ctgtccacggtcgagcccggcaggcgcggcaagaaggacggccagggcctgtacacgtgg
cagaagaccgagaagggcagcaagccggtcaagccggaggtgccgcagggttacaaggcc
ccggaggacctggaggaccgcctcatcctgccgctgctcaacgaggcggtagcctgcctg
cacgatggcgtggtcgacgatgccgacctgctcgatgccggcgtgatcttcggtaccggc
ttcgcaccgttccgcggcggcccgatccagcacatccgcgccaccggcgccgacgtcctg
ctggagaagctcaagacgctgcaggcgcgccacggcgagcgcttcgccccgcgccagggc
tgggacagcgcgctgctgcgccagccgccggtgtaa

DBGET integrated database retrieval system