KEGG   Pelolinea submarina: Pelsub_P2606Help
Entry
Pelsub_P2606      CDS       T05783                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psub  Pelolinea submarina
Pathway
psub00010  Glycolysis / Gluconeogenesis
psub00053  Ascorbate and aldarate metabolism
psub00071  Fatty acid degradation
psub00280  Valine, leucine and isoleucine degradation
psub00310  Lysine degradation
psub00330  Arginine and proline metabolism
psub00340  Histidine metabolism
psub00380  Tryptophan metabolism
psub00410  beta-Alanine metabolism
psub00561  Glycerolipid metabolism
psub00620  Pyruvate metabolism
psub00625  Chloroalkane and chloroalkene degradation
psub01100  Metabolic pathways
psub01110  Biosynthesis of secondary metabolites
psub01120  Microbial metabolism in diverse environments
psub01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pelsub_P2606
   00053 Ascorbate and aldarate metabolism
    Pelsub_P2606
   00620 Pyruvate metabolism
    Pelsub_P2606
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pelsub_P2606
   00561 Glycerolipid metabolism
    Pelsub_P2606
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pelsub_P2606
   00310 Lysine degradation
    Pelsub_P2606
   00330 Arginine and proline metabolism
    Pelsub_P2606
   00340 Histidine metabolism
    Pelsub_P2606
   00380 Tryptophan metabolism
    Pelsub_P2606
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pelsub_P2606
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pelsub_P2606
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pelsub_P2606
Enzymes [BR:psub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Pelsub_P2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BBB49375
Position
3022029..3023396
Genome map
AA seq 455 aa AA seqDB search
MEISEIIQAQKAYFQSGKTLEVSARLEALGRLRSAIETREEEILEALREDLGKSRFEGYM
SEVGMVLDELSYMRRNLTRLASPQRVRTPLAQFSARSFRLPSPYGCALVMSPWNYPFYLS
ITPMIDALAAGNTVVVKPSAYSPATSALVVELVRECFQPEIAAVVTGGRDVNQSLLDQPF
DTIFFTGSKTVGRLVMEKASAHLTPITLELGGKSPCIVDRSADLKTAAARIAFGKFLNVG
QTCVAPDYLIVHADIKDEFLALLAAEIHKQYGEKPLENADYGRIISEKHFQRLLGLMEGG
TIYMGGQHDGSRRMEPTVITDVTLDSPIMQEEIFGPLLPVLTFRETADIYPIVAANPTPL
AFYLFTTDKAQERELSRRISFGGGCINDTIIHLATTEMGFGGVGESGMGSYHGKAGFDTF
THYKSMVNKANWIDLKMRYQPYSEGMLKMVKMFLK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatcagaaattattcaagcccaaaaggcttattttcaatccggtaaaacgctg
gaagtgtctgcgcgcctggaagcactgggacggctgcgcagcgcgatagaaacgcgcgaa
gaagagatcctggaagcgctgcgcgaagacctgggcaaaagccgcttcgaaggctatatg
tccgaggtcggcatggtgctggacgaactttcctatatgcgccgaaacctgacgcgcctg
gcaagcccgcagcgcgtgcgcacgcctttggcgcagttcagcgcgcgcagcttccggctg
ccctccccttacggctgtgccctggtgatgagcccctggaattatcctttctatttgtcc
atcaccccaatgatagacgcgctggcggccggcaatacggtagtggtcaagcccagcgct
tactcccccgcgaccagcgcgctggtggttgaattggtacgggaatgcttccagcccgaa
atcgcggcggtggtgaccggcgggcgcgacgtgaaccagtcgctgctcgaccagcccttc
gataccatcttcttcaccggcagcaaaacagtcggccggctggtgatggaaaaagcctcc
gcgcacctgacccccattacgctggagctgggcggcaaaagcccctgcatcgtggaccgc
agcgccgacctgaaaaccgccgcggcgcgcatcgccttcggcaagttcctcaacgtgggc
cagacctgcgtggcgccggactacctgattgtgcacgcggacatcaaagacgaattcctg
gcgctgctggcagccgagatacataaacaatacggcgaaaagccgctggagaatgccgat
tacgggcgcatcatcagcgaaaagcactttcagcgcctgctgggattgatggaaggcggc
acgatctacatgggcggccagcacgacggctcgcggcgcatggaaccgaccgtgatcacg
gacgttacgctggacagccccatcatgcaggaggagatcttcgggccgctgctgccggtg
ctgacctttcgcgagacggccgatatttaccccatcgtggcggccaacccaaccccgctg
gccttctacctgttcaccaccgacaaggcgcaggagcgcgaattgtcacggcgcatctcc
ttcggcggcggctgcatcaacgacaccatcatccacctggccaccaccgagatgggcttc
ggcggcgtgggcgagagcggcatgggcagctaccacggcaaggccggcttcgataccttc
acgcattacaagagcatggtgaacaaggccaactggatcgacctgaagatgaggtaccag
ccttatagcgaggggatgctgaagatggtgaagatgtttttgaagtaa

DBGET integrated database retrieval system