KEGG   Candidatus Planktophila sulfonica: A1sIA56_02395Help
Entry
A1sIA56_02395     CDS       T05158                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
psuf  Candidatus Planktophila sulfonica
Pathway
psuf00270  Cysteine and methionine metabolism
psuf00920  Sulfur metabolism
psuf01100  Metabolic pathways
psuf01110  Biosynthesis of secondary metabolites
psuf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psuf00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    A1sIA56_02395
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A1sIA56_02395
Enzymes [BR:psuf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     A1sIA56_02395
    2.3.1.46  homoserine O-succinyltransferase
     A1sIA56_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: ASY15770
UniProt: A0A249KG48
Position
475575..476672
Genome map
AA seq 365 aa AA seqDB search
MSRTPNFDVTGAWLEGDDPGDREFVKIGFLLLENGETLPDITIAYQTWGTLNADKSNAIL
INHAMTGWSDVTGWWPQMVGPGLPFDTDKYFIVCPNVIGGCQGSTGPSSIAPDGKRYGSR
FPIITIRDMVNAEVAFSNALGIDKYLLAVGPSLGGMRSLEWAVQLPDRVGAICTIGSSAV
ATGDQIGTASIQIRAIKADPHFNDGDYYEQERGPIDGMGIARRIAHLTYRTESEMDVRFG
RQLQGDETGRYAVESYLDHQATKLAKRFDANTYIALTDAMNSHDIGRDRGGVAAALEAIT
VPVVVVSIDTDRLFPPRLQVEISELVPTADAPITISSDFGHDGFLVEAEAMGDAIRHALK
VAGTI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacacctaacttcgatgtcaccggtgcgtggcttgagggcgatgacccaggc
gatcgtgagttcgtcaagattggtttcttacttcttgaaaatggcgagaccttgccagat
atcactatcgcgtatcaaacatggggaactctcaacgcagataaatccaatgcaatctta
attaaccatgcgatgaccggttggtctgatgtcacagggtggtggccacagatggttggt
cctggtcttccttttgatacagataaatacttcatcgtctgtcccaatgtcattggtggt
tgccaaggatctactggtccttcaagtattgctcccgatggaaaacgttacggttcacgc
tttcccatcatcacgattcgcgacatggtcaacgccgaagttgccttcagtaatgcactt
ggaattgataagtatctattggcagttggtccatctcttggtggaatgcgttcgctggaa
tgggctgtccaacttccagatcgcgtcggtgcaatctgcaccatcggttcatcagctgtt
gccacaggagaccaaatcggcacagcttcgattcaaattcgtgccatcaaagcggaccca
catttcaatgatggcgattactacgagcaagagcgcggaccaatcgatggcatgggaatt
gcccgccgcatcgcgcacctgacctatcgcaccgaatctgagatggatgttcgctttggc
cgccagcttcagggagatgagaccggccgttacgccgttgagtcatacctggaccaccag
gcgacaaagctggccaagagatttgatgccaatacctatatcgctctgactgatgcgatg
aactcacatgacatcggccgcgaccgcggaggagtggcagcagcccttgaagccatcaca
gttccggtcgttgtggtctcgattgataccgatcgcctcttcccacctcgacttcaggtt
gagatatctgagctagttccgactgcagatgcgccaataaccatcagttctgactttgga
cacgatggattcttagttgaggcagaggcgatgggcgatgcgattcggcacgccttgaag
gttgcgggtacaatatag

DBGET integrated database retrieval system