KEGG   Candidatus Planktophila sulfonica: A1sIA56_05570Help
Entry
A1sIA56_05570     CDS       T05158                                 

Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psuf  Candidatus Planktophila sulfonica
Pathway
psuf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psuf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A1sIA56_05570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psuf03011]
    A1sIA56_05570
Ribosome [BR:psuf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A1sIA56_05570
  Bacteria
    A1sIA56_05570
  Archaea
    A1sIA56_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 CDPS SpoIISB_antitox
Motif
Other DBs
NCBI-ProteinID: ASY16357
UniProt: A0A249KHU9
Position
complement(1095895..1096383)
Genome map
AA seq 162 aa AA seqDB search
MIGEHHVANTQDALVARAVLRDIRHTPQKARRVVDLVRGMRADEALNVLKFAPQAAGTDV
YTLLNSAIANAKQQNPAIRDASELWVVEALVDEGRTMKRFRPRAQGRGFRILKRSSHISV
AVSDTKATSKSISRTSNRAQTRNPKRSEKSPLNTQAAKGASN
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatcggagagcatcacgtggctaatacacaagacgcactcgtagctcgcgcagtattg
cgcgacattcgccacacaccacagaaggctcgtcgcgttgtcgacttggttcgtggaatg
cgtgcggatgaagcacttaacgttctcaagtttgcaccacaggctgcaggaacagacgtg
tacacacttcttaactctgcaatcgcaaatgcgaagcagcagaacccagcaatccgtgat
gcttcagagctctgggttgtagaagcactcgttgacgagggacgcacaatgaagcgtttc
cgcccacgtgcacagggtcgcggtttccgtatcctcaagcgctcaagccacatctcagta
gctgtcagcgatacaaaggcgacttcgaagtcaatctctcgcacatcaaaccgtgcgcag
acacgcaatccaaagcgttctgaaaagtcaccactcaatacacaagcagcgaagggagcg
tccaactaa

DBGET integrated database retrieval system