KEGG   Pseudarthrobacter sulfonivorans: AU252_00225Help
Entry
AU252_00225       CDS       T04210                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AU252_00225
Enzymes [BR:psul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AU252_00225
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AU252_00225
    1.1.1.-  
     AU252_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ALV39782
UniProt: A0A0U3GKR7
Position
complement(51068..52117)
Genome map
AA seq 349 aa AA seqDB search
MRAAVYYGKNKLEIEDVPEPTPGEGQVKIKVSRNGICGTDLHEYYDGPIFIPPTDPHPLT
GQCMPLTLGHEFSGVVTEIGPNVTDIREGDRVTIEPIYRCGECRPCRTGHYNLCNVIGFH
GLMADGGMAEYTVVPSNQVHKLPDNVSLEMGALVEPMSVAYHAATLGEVNDQSRALIYGA
GPIGIGLWFALRGMGLTEIDVVEPSETRRRSIEALGARTLDPTKQDVTALIADRTNGNGV
DAAFDAAGVAPAVQSALECLGERRPLISVAIYEKPLPTPLINLVLRERRIQGTICYTAAD
YSAVIDLMAKGHYNTTGWVEDVPLSGVVEKGFEQLRAGQKMKLLVDPTT
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcagtctattacggcaaaaacaaacttgaaatcgaagacgtaccggaacca
accccaggcgaaggccaggtgaagatcaaagtcagccgcaacggaatctgcggcaccgac
ctccacgaatactacgacgggccgatcttcataccgcccacggaccctcacccgctcaca
ggacaatgcatgcccctgacgctgggccatgaattctctggtgtagtcaccgagatcggc
ccaaacgtcacggatattcgcgagggcgaccgcgtcaccatcgagcccatatatcgctgt
ggtgagtgccgaccgtgcaggaccggccactacaatctatgcaatgtgatcggcttccac
ggcctcatggccgacggcgggatggcggaatacacggtcgtgcccagcaaccaggtccat
aaactccccgataacgtctcgctggagatgggagcattggtcgaaccgatgtccgtcgcc
taccacgcggccacgctcggtgaagtcaacgatcaaagcagggccttaatctacggcgca
ggacccatcggcatcggcctctggttcgcgctgcgtgggatgggcctgaccgaaatcgac
gtggttgaaccatccgagacccgccgcaggtccatcgaggcactcggcgcacgcaccctg
gacccgaccaaacaggacgtgaccgccctcatcgccgaccggaccaacggcaacggagtc
gacgccgcattcgacgccgccggcgtagcccccgcagtccaatcagccctcgaatgcctc
ggcgaacgccgccccctgatcagcgtcgcaatctacgaaaaacccctccccacacccctc
atcaacctcgtgctccgcgaacgacgcatccaaggcaccatctgctacaccgcagccgac
tactccgcagtcatcgacctcatggcaaaaggccactacaataccaccggatgggtggag
gacgttcccctcagcggcgtggtcgaaaagggattcgaacagctccgtgccggccaaaaa
atgaagctgctggtggaccccacaacgtag

DBGET integrated database retrieval system