KEGG   Pseudarthrobacter sulfonivorans: AU252_01555Help
Entry
AU252_01555       CDS       T04210                                 

Definition
(GenBank) carnitine dehydratase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00010  Glycolysis / Gluconeogenesis
psul00053  Ascorbate and aldarate metabolism
psul00071  Fatty acid degradation
psul00280  Valine, leucine and isoleucine degradation
psul00310  Lysine degradation
psul00330  Arginine and proline metabolism
psul00340  Histidine metabolism
psul00380  Tryptophan metabolism
psul00410  beta-Alanine metabolism
psul00561  Glycerolipid metabolism
psul00620  Pyruvate metabolism
psul00625  Chloroalkane and chloroalkene degradation
psul00903  Limonene and pinene degradation
psul01100  Metabolic pathways
psul01110  Biosynthesis of secondary metabolites
psul01120  Microbial metabolism in diverse environments
psul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AU252_01555
   00053 Ascorbate and aldarate metabolism
    AU252_01555
   00620 Pyruvate metabolism
    AU252_01555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AU252_01555
   00561 Glycerolipid metabolism
    AU252_01555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AU252_01555
   00310 Lysine degradation
    AU252_01555
   00330 Arginine and proline metabolism
    AU252_01555
   00340 Histidine metabolism
    AU252_01555
   00380 Tryptophan metabolism
    AU252_01555
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AU252_01555
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AU252_01555
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AU252_01555
Enzymes [BR:psul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AU252_01555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ALV40013
UniProt: A0A0U3Q6T4
Position
complement(359499..361025)
Genome map
AA seq 508 aa AA seqDB search
MTTTNERHVAERFSVESDRSYSMLIDGAWVQSSSGETFACVDPYDNASWGRVPAATVEDV
DRAVRAARRAFDEGGWPQTLPSQRAALLRRFADLLTENADELARGQIHENGKLIGEMTWG
ALQMGQHAHYVAGLAETIQGRTIESNWPNTAAFTFREPIGVVAMITPWNSPLMLLSWKLF
AALAAGNTVVIKPSEATPTSTLRMAELAMEAGFPPGVINVVTGFGQPTGSALVDHRGVDK
IAFTGSTSAGRAINKQAAERFARVTLELGGKSPNIIFSDADIDNAVHGAMAGIFGATGQT
CMGGSRVLVQDSIYDDFVDRMARATQALTLGDPLDPTVDMGPVSNRAQFQKVIDYVDLGQ
SEGAEVVAGGARCMTTSELSKGLFFEPTVFANVSNESRLAQEEIFGPVASIIRFRDEDEA
VKIANASDFGLAAGVWTNDVSRAHRMIRRVRSGTVWVNTYRLTNYSVPFGGFKQSGIGRE
LGPDALDAYTEVKSAWIDLGNQQAFGRH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaacgaacgaacggcacgtcgccgaaagattttcggtagagagcgatcgctct
tactccatgttgatagacggcgcttgggtgcagtccagcagcggtgagaccttcgcttgc
gtagatccatatgacaacgcgagttggggcagagtccccgcggcaactgtcgaggacgtc
gaccgggcagtcagggcagctcgtcgggcgttcgacgaaggcggatggccgcaaacgttg
ccatcccagcgggcagctctgctgcgccgtttcgcggacctgctgacggaaaatgccgac
gagctcgcacgcggacaaatccatgagaacggtaagctcatcggcgaaatgacgtggggt
gcgctccagatggggcagcacgcgcactacgtcgctgggctcgccgagacgattcagggc
cggacaatcgagtcgaactggcccaacaccgccgcattcactttccgagagccgattggg
gtggtggccatgatcaccccatggaactcaccgctgatgcttctgtcatggaagttgttc
gcagcgttagcagccggcaacactgtggtaatcaagccctcggaggccaccccaacctcg
acgttgaggatggcggaactggccatggaggctggcttcccgcccggcgtaatcaacgtc
gtcaccgggttcggacagcccaccggatcagcgctggtcgatcaccgaggggtggacaag
atcgccttcaccggctcgacgtccgctggtcgcgcaatcaacaaacaggccgctgagcga
ttcgcgcgggtaacgctcgagttgggcggcaagtctcccaacatcatcttttccgatgct
gatattgacaacgcagtgcatggtgccatggccgggatttttggagcaaccgggcagacc
tgcatgggtggttcccgagtactggttcaggactcgatctatgacgatttcgttgaccgc
atggcccgcgctacacaggccttgacgttgggtgacccactcgaccccactgtcgacatg
ggtcctgtctcgaaccgcgctcaattccaaaaggttatcgactatgtcgaccttgggcag
tcggagggagccgaagttgtcgccggcggagccaggtgtatgacgaccagcgaactcagc
aagggactcttcttcgaaccgacagtgttcgccaacgtaagcaacgaatctcgacttgcc
caagaggagatcttcggaccggtcgccagcatcatccggttccgcgacgaggacgaggcg
gttaagatcgccaatgccagcgatttcggtctcgcggcaggtgtttggacgaatgacgta
agccgggcccaccgcatgatccgccgcgtccgaagcggcacggtgtgggtgaacacatac
cgcttgacaaactattcggtccctttcggtggcttcaaacaaagtggcatcggccgtgag
ctcggtccagatgcactcgacgcatacaccgaagtcaagtcggcctggattgacctcgga
aaccagcaggcattcggccgtcactag

DBGET integrated database retrieval system