KEGG   Pseudarthrobacter sulfonivorans: AU252_07360Help
Entry
AU252_07360       CDS       T04210                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00480  Glutathione metabolism
psul00590  Arachidonic acid metabolism
psul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AU252_07360
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AU252_07360
Enzymes [BR:psul01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AU252_07360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ALV40993
UniProt: A0A0U3R737
Position
complement(1681530..1682057)
Genome map
AA seq 175 aa AA seqDB search
MTDLYTIPLTLNDGTETDFGRFKGNVVVVVNVASKCGFTPQYAGLETLYEKFRDRGFDVL
GVPCNQFAGQEPGNDSEIAEFCERNFGVTFPLTAKANVRGKDQHPLYAELTRFKTSVLPG
LVKWNFEKFLVNREGEVVARFAPTVEPDSAEVIDAIEMALAEFDGPAATIELSKA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgacagacctgtacaccattcccctcactctcaacgacggcaccgaaaccgactttggc
cggttcaagggcaacgtggtggtggtggtgaacgtggcgtcaaagtgcggtttcactccg
cagtacgcgggcctggagacgctatacgagaagttccgcgaccgcggcttcgatgtgctc
ggagttccgtgcaaccagttcgccggccaggagccaggcaacgacagtgagatcgccgag
ttctgcgagcggaatttcggtgtcactttcccgctgacggccaaggccaacgtgcgtggc
aaggaccagcatccgctctatgccgagctgaccaggttcaaaaccagtgtgctgccaggc
ctggtgaaatggaacttcgagaagttcctggtcaaccgcgagggcgaggtggtggcacgc
ttcgcgcccaccgtcgaaccggactccgccgaggtcatcgacgcaattgaaatggcactg
gcagaatttgacggaccggcggccacaatcgaactttccaaggcttaa

DBGET integrated database retrieval system