KEGG   Pseudarthrobacter sulfonivorans: AU252_09215Help
Entry
AU252_09215       CDS       T04210                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00520  Amino sugar and nucleotide sugar metabolism
psul01100  Metabolic pathways
psul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AU252_09215
Enzymes [BR:psul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AU252_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALV41307
UniProt: A0A0U3QIG7
Position
2069519..2070790
Genome map
AA seq 423 aa AA seqDB search
MNPPPERVQPEQTQPTGAEPGNYLLAGTVLTDGSIQDDAVVAVADGRIVYVGPRAGLDEA
SLPGLEELELPRGSMILPGLVDLHCHGAVGGDFPSGDSEAARTAVDFLHRSGTTTLLAST
VTASREDLLRGLETLRLLADEGLIAGIHSEGPFLSHARCGAQDPRYLREPNLPLLGELLA
AAGGHLRTMTYAPELPGADAVVRMLAEHGVTPSLGHTDADARTTAASLTEAAELLAASGL
GTASRPTITHLFNGMPPLHHRSPGPVAACLRLAGAGTIAVELIADGAHLDPETVRMVFEL
VGAENVVLVTDSMAATGLPDGDYELGPAAVSVIGAVARLSNGTLAGGTATLLDVVRRTIN
AGVEPAAAVLSATAVPAAIIGQSQEFGSLRAGLRADVVVVDRNFRRVLVLREGRTLGRPA
VGV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccgccgccggaacgagtacagccggaacaaacacagcccaccggcgctgagccc
gggaactacctgctggccggcacggtcctgaccgacggttcgatccaggacgacgcagtg
gtggccgtcgcggacggccgcatcgtatatgtggggccccgcgccggtcttgatgaggcg
tcgctgcccggccttgaggaactcgaactgccgcggggcagcatgattctgcccggcctc
gtggacctgcactgccacggggccgtgggcggcgacttcccgagcggcgacagcgaggct
gccaggaccgccgtggacttcctgcaccgcagcggcaccaccacgctgctggcaagcacg
gtgaccgcgtcccgcgaggacctgctgcgcggcctggaaaccctgcggctacttgccgat
gaagggctcatcgcgggcatccactccgaggggccgttcctgtcccacgcgcgatgcggc
gcccaggatccgcggtacctgcgcgaaccgaacctccccctgctgggcgaactgctggcc
gcggccggcggccacctgcggaccatgacgtacgcgcccgaacttcccggcgccgacgcc
gtggtgcggatgctcgccgagcacggcgtcacgccgtcgctgggccacactgacgcggac
gcgcggacgacggcggcctccctcaccgaggcggcggagctgctggcggcatcaggcctg
gggaccgcatcgcgccccaccatcacacacctctttaacggcatgccgccgctgcaccac
cgcagtccagggcctgttgccgcatgcctccggctggccggggccggcacgattgccgtg
gaactcatcgccgacggcgcgcacctggaccccgaaacggtccggatggtcttcgagctg
gtgggggccgaaaacgtagttctggtgaccgactccatggccgccaccggactgcccgac
ggcgactacgagcttggccccgcagccgtctccgtcattggagcggtggcccggctcagc
aacggcaccctcgccggcgggacggccaccctgctggatgttgtgcggcggaccattaac
gccggggtggagccggccgccgctgttctgtcagccaccgccgttccggcggccatcatc
ggccagtcgcaggaattcggaagcctccgcgcggggctgcgggccgacgtcgtagtggtg
gaccgcaacttccgccgcgtcctggtcctgcgcgaggggcgcaccctgggccgccccgcc
gtcggggtctag

DBGET integrated database retrieval system