KEGG   Pseudarthrobacter sulfonivorans: AU252_11005Help
Entry
AU252_11005       CDS       T04210                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00051  Fructose and mannose metabolism
psul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AU252_11005
Enzymes [BR:psul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AU252_11005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP UDPG_MGDP_dh_N ApbA
Motif
Other DBs
NCBI-ProteinID: ALV41614
UniProt: A0A0U3Q4Q8
Position
2460138..2461301
Genome map
AA seq 387 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLHQAGYEVVFADVADALIDQLAAADSYNVHEVGENPIVRTV
DNFRALNSGTQEAALVREIATADIVTTAVGPHILKFVAPAITKGIAARAAGLAPLQVMAC
ENAINATDILRAEVAALWDDAAGSLDDAAVFANTAVDRIVPNQAPGQGLDVTVETFYEWV
IDRTAFGDAAPVIPGATFVDELSPYIERKLFTVNTGHASAAYFGFEAGLEKISEAMADQD
VAEDVRAVLEETKQLLVAKHGFNNDEQEAYVQKILVRFSNPHLPDTVNRVGRAPMRKLSR
HERFIGPAAELAERGIVPEALLGAIAAALRFTDPADAEATELAQILAASSAADATAKITG
LAPEHPLFAAVSTLVEERQAEGAKAPA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcagtacatttcggagccgggaacatcggccgcggctttgtggggctgctgctg
caccaggccggttatgaggtggtcttcgcggatgtcgcggacgcactcatcgaccagctc
gcggcagcagacagctacaacgtccacgaggtgggggagaaccccatcgtccggacggtg
gacaacttccgcgcactgaactccggcacgcaggaagcggcgctggtgcgggaaatcgcg
acggcggacattgtcaccacagccgtggggccgcacatcttgaagttcgtggcccccgcc
atcaccaagggcatcgcggcgcgggctgccgggctggcgccgctgcaggtcatggcctgc
gagaacgccattaacgccacggacatcctgcgggccgaagtcgccgccctttgggacgac
gccgccggctccctggacgacgcggcggtgtttgcgaacaccgccgtggaccggattgtg
cccaaccaggcgccgggccagggcctggacgtcacggtggagacgttctacgagtgggtc
atcgaccggacagcgtttggcgatgcggccccggtcatcccaggcgcaaccttcgtggac
gagctctcgccctacatcgagcggaagctcttcaccgtgaatacggggcacgcctccgct
gcgtacttcggctttgaggccgggctggaaaagatctccgaggccatggccgaccaggac
gtggcggaagacgtccgcgcggtcctcgaggaaaccaagcagctccttgtggccaagcac
ggcttcaacaacgatgagcaggaggcctacgtccagaagatcctggtccggttctccaac
ccacatctgccggacaccgtgaaccgggtgggccgcgccccgatgcgcaagctcagccgg
cacgaacggttcatcggcccggctgccgaactggccgaacgcgggatcgtgccggaggcg
ctcctgggtgccatcgccgctgccctgcgcttcaccgaccccgccgacgccgaggccacc
gagctcgcgcagatcctggcggcatcatcggcggctgacgccacggccaagatcaccggg
ctggcgccggagcacccgctgttcgcggcggtgtccacgctggtggaggaacgccaggcg
gaaggggcgaaggccccggcctga

DBGET integrated database retrieval system