KEGG   Pseudarthrobacter sulfonivorans: AU252_15110Help
Entry
AU252_15110       CDS       T04210                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00430  Taurine and hypotaurine metabolism
psul00620  Pyruvate metabolism
psul00640  Propanoate metabolism
psul00680  Methane metabolism
psul01100  Metabolic pathways
psul01120  Microbial metabolism in diverse environments
psul01200  Carbon metabolism
Module
psul_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AU252_15110
   00640 Propanoate metabolism
    AU252_15110
  09102 Energy metabolism
   00680 Methane metabolism
    AU252_15110
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AU252_15110
Enzymes [BR:psul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AU252_15110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ALV42310
UniProt: A0A0U3GSZ5
Position
3337876..3339030
Genome map
AA seq 384 aa AA seqDB search
MLVLVINSGSSSLKYQVRDVAAGIVLTEGLIEKIGMGNGGDGDGEIEGPRDHAEALELVD
AAIHAELGDLELAAVGHRVVHGGERFAEPVLIDNEITRAIERLNPLAPLHNPANVLGIRA
ISKKWPDLPQVAVFDTAFHRTLPEHAWRYAVPDELYTNHGIRRYGFHGTSHEYVTHRAAS
LLDLPVDEFDGVIAHLGNGASVTAIRRGHSVDTSMGFTPLEGLVMGTRSGDLDPSILVFL
GRNGWTPEDIDSMLNRESGLKGLAGNNDMRSVVEASEAGDAKASMALAVTSYRLAKYIGG
YHVAVGGAKALVFTAGIGENSHQFRALVTDRLRALGIELDVGLNSQRSKEPRVISSAESV
IPVLVVPTDEERAIAEATAAVVGG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgctcgtcatcaactccggttcgtcctcgctcaagtaccaggtccgtgacgtg
gccgccggcattgtgctgaccgaggggctgatcgagaagatcggcatgggcaacggcggt
gatggcgacggcgaaatcgagggcccccgggaccatgcggaggcgctggaactggtagat
gccgcgatccatgccgagctcggcgaccttgagctggctgcggtgggccaccgcgtggtg
cacggcggcgaacgtttcgccgagccggtgctgatcgacaacgagatcacccgcgccatc
gagcgcctcaatccgctggcgccgctgcacaaccccgccaatgtcctgggcatccgcgcc
atcagcaagaagtggccggacctgccgcaggtggccgtgttcgacaccgctttccaccgc
accctgccggagcacgcctggcgctacgccgtcccggacgagctctacacgaaccacggc
atccgccgctatggcttccacggcacctcgcacgagtacgtcacgcaccgcgccgcatcg
ctgctggatctgcccgtggacgagttcgacggcgtgatcgcccacctggggaacggcgcc
tccgtcacggccatccgccgcggtcattcggtggacacgtccatgggcttcaccccgctg
gagggcctggtgatgggcacccgctcgggtgacctcgatccctccatcctggtattcctc
ggccggaacgggtggacgccggaggacatcgacagcatgctcaaccgcgagtcgggtctc
aaggggctcgccgggaacaacgacatgcgctcggtggtggaggcgtcagaggctggcgac
gccaaggcttcaatggcgctcgcggtcacgtcctaccggctggcaaagtacatcggcggc
taccacgtggccgtcgggggtgccaaggccctcgtgttcacggcggggatcggcgaaaac
tcgcaccagttccgcgccctggtgactgacaggctgcgtgcgctggggatagagctcgac
gtcggcctgaacagtcagcgctccaaggaaccgcgggtgatttcctcggctgagtccgtc
atcccggtgttggtggtgcccaccgacgaggagcgcgccatcgcagaggcaactgccgcc
gtcgttggtggttga

DBGET integrated database retrieval system