KEGG   Pseudoxanthomonas suwonensis J1: WQ53_15270Help
Entry
WQ53_15270        CDS       T04241                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psuw  Pseudoxanthomonas suwonensis J1
Pathway
psuw00071  Fatty acid degradation
psuw00072  Synthesis and degradation of ketone bodies
psuw00280  Valine, leucine and isoleucine degradation
psuw00310  Lysine degradation
psuw00362  Benzoate degradation
psuw00380  Tryptophan metabolism
psuw00620  Pyruvate metabolism
psuw00630  Glyoxylate and dicarboxylate metabolism
psuw00640  Propanoate metabolism
psuw00650  Butanoate metabolism
psuw00900  Terpenoid backbone biosynthesis
psuw01100  Metabolic pathways
psuw01110  Biosynthesis of secondary metabolites
psuw01120  Microbial metabolism in diverse environments
psuw01130  Biosynthesis of antibiotics
psuw01200  Carbon metabolism
psuw01212  Fatty acid metabolism
psuw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psuw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WQ53_15270
   00630 Glyoxylate and dicarboxylate metabolism
    WQ53_15270
   00640 Propanoate metabolism
    WQ53_15270
   00650 Butanoate metabolism
    WQ53_15270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WQ53_15270
   00072 Synthesis and degradation of ketone bodies
    WQ53_15270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WQ53_15270
   00310 Lysine degradation
    WQ53_15270
   00380 Tryptophan metabolism
    WQ53_15270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WQ53_15270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WQ53_15270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WQ53_15270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psuw04147]
    WQ53_15270
Enzymes [BR:psuw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WQ53_15270
Exosome [BR:psuw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WQ53_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C B12-binding DUF3323 ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKC87928
UniProt: A0A0E3Z3A1
Position
complement(3671416..3672591)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIAAAKRTAIGSFLGQFTGVPTPTLGAAAIAAALEQSGIPADDVSEVIMGCVLPAN
LGQAPARQAALAAGLPSSAGATTINKVCGSGMKAIMLGHDLIKAGSATIVVAGGMESMSN
APHLIPNSRTGNRYGAFQAVDHMAWDGLTNPYDGQAMGVFAEKTVEKYGFTREEQDAFAI
ESVTRSQAAQSSGAFDGEIVPVKVATRKGEVEVASDEQPGKSDVAKIPTLRPAFKKDGSV
TAASSSSISDGAAATVLLSAEEAARRGVQPLARIVGHSTFSHQPEWFTTAPVGAISTLLD
KVGWKVEDVDLFEINEAFAVVAMAPIKELGIPHAKVNINGGACALGHPIGASGARLVVTL
INALRKQGLKRGVAALCIGGGEATAVAVETL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgccgccgccaagcgcaccgccatcggctcgttcctcggccag
ttcaccggcgtgcccacgccgaccctcggcgcggccgcgatcgccgccgccctggagcag
tccggcatccccgccgacgacgtgtccgaggtgatcatgggctgcgtgctgccggccaac
ctcggccaggcgcccgcccgccaggccgcgctggccgccggcctgccgagctcggctggc
gccaccaccatcaacaaggtctgcggctcgggcatgaaggcgatcatgctcggccacgac
ctgatcaaggccggctcggccaccatcgtcgtcgccggtggcatggagtcgatgagcaac
gcgccgcacctgatccccaactcgcgcaccggcaaccgctacggcgccttccaggcggtc
gaccacatggcgtgggacggcctgaccaacccgtacgacggccaggccatgggcgtgttc
gccgagaagaccgtcgagaagtacggcttcacccgcgaggagcaggacgctttcgccatc
gagtcggtcacccgctcgcaggccgcgcagtcctccggcgcgttcgacggcgagatcgtc
ccggtcaaggtcgccacccgcaagggcgaggtcgaggtcgccagcgacgagcagcccggc
aagtcggacgtggccaagatcccgaccctgaggccggcgttcaagaaggacggcagcgtc
accgccgccagttcctcgtccatctccgacggcgcggcggccaccgtgctgctgtcggcc
gaggaagccgcgcgccgcggcgtgcagccgctggcgcgcatcgtcggccacagcaccttc
tcgcaccagccggaatggttcaccaccgccccggtcggcgcgatctccaccctgctcgac
aaggtcggctggaaggtggaggacgtggacctgttcgagatcaacgaagccttcgccgtg
gtggccatggcgccgatcaaggaactgggcatcccgcacgccaaggtcaacatcaacggc
ggcgcctgcgccctgggccatccgatcggcgcctccggcgcccgcctggtggtgaccctg
atcaatgccctgcgcaagcaggggctgaagcggggcgtcgccgcgctgtgcatcggcggc
ggagaagccaccgcggtggcggtggaaacgctgtaa

DBGET integrated database retrieval system