KEGG   Pseudomonas sp. VLB120: PVLB_06110Help
Entry
PVLB_06110        CDS       T02897                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00480  Glutathione metabolism
psv00590  Arachidonic acid metabolism
psv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PVLB_06110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PVLB_06110
Enzymes [BR:psv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PVLB_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AGZ34029
Position
1379446..1379997
Genome map
AA seq 183 aa AA seqDB search
MRVPWLTLPLLALLAATPTWAADCPALLQGTLPELRGKEQVDLCQRFAGKPLVVVNTASY
CGFAPQFEGLEAAYKEYHEQGLEMLGVPSNDFKQEAGDSEETAKVCYANYGVTFTMTKAQ
PVRGEDAIPLFAELASQSSAPKWNFYKYVVDRKGKVIGNFSSLTKPDDPAFRAAIEKAIA
SQP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtaccttggttgaccctgccattgttggccctgttggccgccactcccacttgg
gccgctgactgcccggcgctgttgcagggcactttgcccgagctgcgcggtaaagagcag
gtcgacctgtgccagcgcttcgccggcaaacccctggtggtggtgaacaccgccagctac
tgtggtttcgccccgcaattcgaagggctcgaagccgcctacaaggagtaccacgagcag
ggcctggaaatgctcggcgtgccgtccaacgacttcaaacaggaagccggtgacagcgaa
gagactgccaaggtgtgctacgccaactatggcgtgacgttcaccatgaccaaggcccag
ccggtgcgtggcgaggacgcgatcccgctgttcgccgaactggccagccaaagcagcgcg
ccgaaatggaatttctacaagtacgtggtcgaccgcaagggtaaggtgatcggcaatttc
tccagcttgaccaagcctgacgacccagccttcagggccgcgatcgaaaaggccatcgca
tcgcagccctga

DBGET integrated database retrieval system