KEGG   Pseudomonas sp. VLB120: PVLB_08675Help
Entry
PVLB_08675        CDS       T02897                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00071  Fatty acid degradation
psv00072  Synthesis and degradation of ketone bodies
psv00280  Valine, leucine and isoleucine degradation
psv00310  Lysine degradation
psv00362  Benzoate degradation
psv00380  Tryptophan metabolism
psv00620  Pyruvate metabolism
psv00630  Glyoxylate and dicarboxylate metabolism
psv00640  Propanoate metabolism
psv00650  Butanoate metabolism
psv00900  Terpenoid backbone biosynthesis
psv01100  Metabolic pathways
psv01110  Biosynthesis of secondary metabolites
psv01120  Microbial metabolism in diverse environments
psv01130  Biosynthesis of antibiotics
psv01200  Carbon metabolism
psv01212  Fatty acid metabolism
psv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PVLB_08675
   00630 Glyoxylate and dicarboxylate metabolism
    PVLB_08675
   00640 Propanoate metabolism
    PVLB_08675
   00650 Butanoate metabolism
    PVLB_08675
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PVLB_08675
   00072 Synthesis and degradation of ketone bodies
    PVLB_08675
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PVLB_08675
   00310 Lysine degradation
    PVLB_08675
   00380 Tryptophan metabolism
    PVLB_08675
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PVLB_08675
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PVLB_08675
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PVLB_08675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psv04147]
    PVLB_08675
Enzymes [BR:psv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PVLB_08675
Exosome [BR:psv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PVLB_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGZ34535
Position
1976586..1977779
Genome map
AA seq 397 aa AA seqDB search
MTIANDPIVIVSAVRTPMGGLQGELKSLTAPQLGSAAIRAAVERAGVDAASVEQVLFGCV
LPAGQGQAPARQAALGAGLDKHTTCTTLNKMCGSGMQAAIMAHDLLLAGSADVVVAGGME
SMTNAPYLLDKARGGYRMGHGRIIDHMFMDGLEDAYDKGRLMGTFAEDCAQANGFSREAQ
DNFAIASLTRAQEAIRNGRFAAEIVPVEVTEGKEKRLVKDDEQPPKAKLDKIPQLKPAFR
EGGTVTAANSSSISDGAAALVLMRRSEADKRGLKPLAVIHGHSAFADTPALFPTAPIGAI
DKLMKRTGWNLAEVDLFEINEAFAVVTLAAMKHLDLPSEKVNIHGGACALGHPIGASGAR
ILVTLLSALRQNNLRRGVAAICIGGGEATAMAVECLY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgccaacgatccgatcgtcatcgtcagcgctgtgcgcacgcccatgggtggg
ttgcagggcgaactcaagagcctgaccgcgccgcaactgggcagcgccgccatccgcgcc
gccgtcgagcgcgctggggtcgatgccgccagtgtcgagcaggtgctgttcggctgtgtg
ctgccggcaggtcagggccaggcaccggcccgccaggctgcgttgggcgccgggctcgac
aagcacaccacgtgcaccaccctgaacaagatgtgtggctcgggcatgcaggcggccatc
atggcccatgacctgctgctggccggcagcgccgatgtggtggtggcggggggcatggag
agcatgaccaacgcaccgtatttgctagacaaagcccgtggcggctaccgcatgggccac
ggcaggatcatcgaccacatgttcatggatggcctggaggatgcgtatgacaaagggcgc
ctgatgggaaccttcgccgaggactgcgcccaggccaacggattcagccgcgaagcgcag
gataactttgcaatcgcgtcgttgacccgtgcccaggaagccatcaggaacgggcgcttc
gccgccgagattgtcccggtcgaggtcaccgagggtaaggaaaagcgcctggtcaaggat
gacgagcagccgcccaaggcgaagctggacaagatcccgcagctcaagccggccttccgc
gaaggcggtaccgtgacagccgccaactccagttcgatttccgacggtgctgccgcactg
gtgctgatgcgtcgctccgaagccgacaaacgcggcctcaagccactggcggtcatccat
ggacactccgcattcgccgatacgccggcactgttcccaaccgcaccgatcggtgcgatc
gacaaattgatgaagcgcaccggctggaacctggccgaggtcgacctgttcgaaatcaac
gaggcattcgccgtggtcaccctggcggccatgaaacacctcgacctaccctctgaaaag
gtcaacatccatggcggcgcctgcgccctgggccaccccatcggtgcctcgggcgcgcgc
atcctggtgaccctgctgtcggccctgcgccagaacaacttgcgccgtggcgtggcagcg
atctgcatcggcggcggcgaagccactgccatggccgtcgaatgcctgtattga

DBGET integrated database retrieval system