KEGG   Pseudomonas sp. VLB120: PVLB_09900Help
Entry
PVLB_09900        CDS       T02897                                 

Definition
(GenBank) sigma-54 dependent transcriptional regulator
  KO
K11914  sigma-54 dependent transcriptional regulator
Organism
psv  Pseudomonas sp. VLB120
Brite
KEGG Orthology (KO) [BR:psv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psv03000]
    PVLB_09900
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psv02044]
    PVLB_09900
Transcription factors [BR:psv03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    PVLB_09900
Secretion system [BR:psv02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PVLB_09900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 GAF_2 GAF_3 HTH_30 AAA_5 HTH_50 HTH_28
Motif
Other DBs
NCBI-ProteinID: AGZ34776
Position
2172981..2174510
Genome map
AA seq 509 aa AA seqDB search
MFTHVPQPLAYAETLMGTFTELACAADEQGLMQALVQAVAGLSGCALVQVYLLDSTHTRL
GLEVACLDGQLQARDCASLPADYNGEQLMQFALCQNRMVSIAELSASMFDTSFLPAQATP
WQALLAVPLVTPQQRVVGVLLCVARARIELAGFADSLGRLGAFAMAQLHLLRRLRQPQPQ
LPASVAKPAEVGSYGLIGDSPAMRQTCQMISKVLHSPYTVLVLGETGTGKELVARAIHDY
GPRRSGPFVVQNCAAFPEHLLESELFGYRKGAFTGADRDRPGLFDAADGGTLLLDEIGDM
PLALQAKLLRVLQEGEIRPLGANSTHKIDVRIVAATHRDLAQMVRDGQFREDLYYRLAQF
PIDLPPLRQRDGDVSALARHFSDKACAFLQRSPVIWSNAALNHLEGYGFPGNVRELKGLV
ERAVVLCEGRELAAEHFALNGAASTAGDGELNLRERLEQVERNLLLDCLRKHDGNQTMAA
RELGLPRRTLLYRLGRLNIQIGDGAGRLA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgcatgtgccgcagcctctggcctatgccgagaccttgatggggaccttcacc
gagctggcctgcgccgctgacgagcagggcctgatgcaggcactggtccaggcggtggcc
gggctcagtggctgcgcgctggtgcaggtgtacttgctcgactcgacccacacgcggctg
gggcttgaggtcgcctgcctcgatgggcagttgcaggcgcgggactgtgccagcctgccg
gccgactacaatggcgagcagttgatgcagttcgccttgtgtcagaaccgcatggtgagc
atcgccgagctgtccgccagcatgttcgacaccagtttcctgccggctcaggcaacacca
tggcaggcgctgctggcggtgcccctggtgaccccgcagcaacgggtggttggcgtgttg
ttgtgcgtagcccgggcgcgcatcgagctggccggctttgccgactcgctgggacgcctc
ggtgctttcgccatggctcagttgcatctgctgcggcgtttgcgtcaaccccagccgcag
ctgccggccagtgtcgccaagccggccgaggtcggtagttacggcctgatcggtgacagc
ccggccatgcgtcagacctgccagatgatcagcaaggtgctgcacagcccttacaccgtg
ctggtgctcggtgagacgggcaccggcaaggaattggtggcccgggccatccacgactac
ggccctcgccgttcggggccattcgtggtgcagaactgcgcggcatttcccgagcacctg
ctggaaagcgagctgttcggttaccgcaaaggcgccttcaccggggccgaccgcgaccgc
ccgggactgttcgacgccgcggacggcggcaccctgttgctcgacgagattggtgacatg
ccgctggcgttgcaggccaagttgctgcgggtgctgcaggagggtgagatccgcccgttg
ggggctaacagcacgcacaagatcgacgtgcgcatcgtcgctgccacgcaccgtgacctg
gcgcagatggtgcgtgacggtcagttccgtgaagacctctattaccgcctggcccagttc
ccgatcgacttgccgccactgcgccagcgtgacggcgatgtgagtgccctggcacggcat
ttttccgataaggcctgtgcgttcctgcagcgcagcccagtgatctggtccaacgccgcc
ctgaaccacctcgaaggctatggcttccctggcaacgttcgcgagctcaaggggctggtg
gagcgcgcggtggtgctctgcgagggccgtgagctggcggcggagcactttgcgctgaac
ggcgccgcatccacagcgggcgatggcgagctgaacctgcgcgaacgcctcgagcaggtc
gagcgcaatctgctgctcgactgcctgcgcaagcacgatggcaaccagaccatggccgct
cgcgagttgggcttgccgcggcgcaccctgctgtaccgactcggtcgcctgaatatccag
atcggcgatggcgcaggccggctggcatga

DBGET integrated database retrieval system