KEGG   Pseudomonas sp. VLB120: PVLB_09910Help
Entry
PVLB_09910        CDS       T02897                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
psv  Pseudomonas sp. VLB120
Brite
KEGG Orthology (KO) [BR:psv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psv02044]
    PVLB_09910
Secretion system [BR:psv02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PVLB_09910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: AGZ34778
Position
2174738..2175919
Genome map
AA seq 393 aa AA seqDB search
MELVFELVDRRQHTRTDSPSKSFGRSGGHIGRAKDCHWCIEDEKRHLSSHHAEVTYREGA
FYLTDQSSNGIRLASSGAQLRKGEAYRIEQGAVYQMGDIEVRARLIETDRALDVGLGIPG
SDIIPDDAFLALDPLSALDNEEARLAPMDELAAMTLPDTPAKQRADYAQIDRENIIVPTL
VPAPVTEPAPQPAPRERRSEAFWERFGAALGVDLAGLDDQAREDLAVQAAGLLRHSIGAL
QQSLRTRSELKNELRLSLTTPQGASRNPIKAPLEADQALGELLKPRRPGQLSAEQAVAQA
FRDLQAHQVALLGASRSALRSTLEHFAPSQLALQFERLGRKPWFGSRWKQYVRYHEALSA
DADWSERLLAKDFAQTYEEQVRLIASLHHDPRG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaactggttttcgagctggtggacagacgccagcacacccgcaccgactcgcccagc
aagtcgtttggccgcagtggcggccacattggacgcgccaaggactgccactggtgcatc
gaggacgaaaagcgccacttgtccagccaccatgccgaggtcacctatcgcgagggcgcc
ttctacctcaccgaccagagcagcaatggcattcgcctggccagcagcggtgcgcaactg
cgcaagggcgaggcctaccgtatcgagcagggggcggtgtaccagatgggcgacatcgag
gtgcgcgcccgcttgatcgaaacggatcgtgccttggatgtagggctcggcataccggga
tcggacatcatccccgatgatgccttcctcgcgcttgacccgctgtccgccctggacaac
gaagaggcgcgccttgcaccgatggatgaactggccgccatgaccttgcccgacaccccg
gccaagcagcgtgccgactacgcccagatcgaccgcgaaaacatcatcgtgccgacgttg
gtgccagccccggttaccgagcctgccccgcaaccggccccgcgcgaacggcgaagtgaa
gcattctgggagcgcttcggcgcagcgctgggcgtcgacctcgccggtctcgacgatcaa
gctcgcgaagacctcgcggtgcaggcagccggtttgctgcgccacagtatcggtgccttg
cagcaaagcttgcgcacccgtagcgagctcaagaacgagttgcgcctgtcgctcaccacc
ccgcaaggcgccagccggaacccgatcaaggcgccgttggaagccgaccaggccctgggc
gagttgctcaagccgcgccggcccggacagttgtcggccgagcaggccgtggcccaggcc
ttccgtgacttgcaggcacaccaggtggctttgcttggtgccagtcgcagcgccttgcgc
agcaccctcgaacactttgcccccagtcagttggcgttgcagttcgaacgcctgggtcgc
aagccgtggttcggtagccgctggaagcaatacgtgcgctaccacgaagcactcagtgcc
gatgccgactggagcgagcgcctgctggccaaggacttcgcccaaacctacgaagagcag
gtgcgcctgatcgcttcccttcaccacgatccgcgaggatga

DBGET integrated database retrieval system