KEGG   Pseudomonas sp. VLB120: PVLB_12665Help
Entry
PVLB_12665        CDS       T02897                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00071  Fatty acid degradation
psv00072  Synthesis and degradation of ketone bodies
psv00280  Valine, leucine and isoleucine degradation
psv00310  Lysine degradation
psv00362  Benzoate degradation
psv00380  Tryptophan metabolism
psv00620  Pyruvate metabolism
psv00630  Glyoxylate and dicarboxylate metabolism
psv00640  Propanoate metabolism
psv00650  Butanoate metabolism
psv00900  Terpenoid backbone biosynthesis
psv01100  Metabolic pathways
psv01110  Biosynthesis of secondary metabolites
psv01120  Microbial metabolism in diverse environments
psv01130  Biosynthesis of antibiotics
psv01200  Carbon metabolism
psv01212  Fatty acid metabolism
psv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PVLB_12665
   00630 Glyoxylate and dicarboxylate metabolism
    PVLB_12665
   00640 Propanoate metabolism
    PVLB_12665
   00650 Butanoate metabolism
    PVLB_12665
  Lipid metabolism
   00071 Fatty acid degradation
    PVLB_12665
   00072 Synthesis and degradation of ketone bodies
    PVLB_12665
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PVLB_12665
   00310 Lysine degradation
    PVLB_12665
   00380 Tryptophan metabolism
    PVLB_12665
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PVLB_12665
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PVLB_12665
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PVLB_12665
Enzymes [BR:psv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PVLB_12665
Exosome [BR:psv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PVLB_12665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2726
Motif
Other DBs
NCBI-ProteinID: AGZ35321
Position
complement(2796123..2797307)
Genome map
AA seq 394 aa AA seqDB search
MQDAVIVSTARTPIAKAWRGAFNDLTTPSMSAIAIRAAVERAGIEPQEVEDLVLGTAMQS
GTAAINPARLSALAAGLPLSVAGQTIDRQCASGLMAIAIGAQQIRSEGMQVVVGAGQEQI
SLVQQAHMQAANAAQDATVRRMCEHAYMPMLQTAERVAQKYGIDREAQDRYALLSQQRTA
AAQHAGLFADEIVAVTAQRKLVDPDTGIQTHQLVHLTQDEGNRPHTQLADLQALRPVIEG
GCVTAGNASQLSDGASACVLMSGDRAARLGQRPLGLYRGMAVVGLAPEEMGIGPVLAIPR
LLARHGLRVQDIGLWELNEAFACQVLYCAEQLDIDPARLNVNGGAIAIGHPYGMSGARMV
GHALLEGRRRNVRYVVVSMCVGGGMGAAGLFEVL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgcagtcatcgtatccacggcgcgtacgcctatcgccaaagcctggcggggc
gccttcaacgacctcactacaccaagcatgagtgccatcgccatccgtgcggcggtcgag
cgcgccggcatagaaccgcaagaggtggaggacctggtgctcggcaccgccatgcaaagc
ggcactgccgcgatcaacccggcgcgcctgtcggcgttggcggccggcttgccgctgtcg
gtggccgggcagaccatcgatcgccaatgcgcctcggggttgatggccatcgccatcggc
gcccagcagattcgcagcgagggtatgcaggtggtggtcggggcagggcaagagcagatc
agcctggtgcagcaggcgcacatgcaggctgccaacgctgcgcaagatgccacggtgcgg
cgcatgtgcgagcacgcctatatgcccatgttgcaaacggctgagcgtgtggcacagaag
tacggcatcgaccgtgaggcgcaggaccgctacgccttgctgtcgcagcagcgcacggct
gccgcgcaacacgctggactcttcgccgacgagatcgttgcggtgaccgctcagcgcaag
ctggtggatccggataccggcatccagactcatcaactcgtgcatctgacccaggacgaa
ggcaaccggccccacacgcaattggctgacttgcaggcgctgcgtccggtgatcgagggc
ggctgtgtgactgccggtaacgccagccagttgtccgacggcgccagtgcatgcgtgctc
atgagcggtgaccgcgcggcccgactggggcaacggccgctggggctgtaccgagggatg
gcggtggtcggcctggcaccggaggaaatgggcattgggcctgtactggcgataccgcgc
ctgttggctcggcacggcttgcgggtgcaagacatcggcctgtgggagctcaacgaggca
ttcgcctgccaggtgctgtattgcgccgagcagttggacatcgacccggcacgcctgaac
gtcaacggcggcgctatcgccatcgggcacccgtatggcatgagcggtgcacgcatggtc
ggccatgccttgctcgaaggccgccggcgcaacgtgcgctacgtagtggtcagcatgtgt
gttggcggaggcatgggcgcggccggattgttcgaggtgctttga

DBGET integrated database retrieval system