KEGG   Pseudomonas sp. VLB120: PVLB_22260Help
Entry
PVLB_22260        CDS       T02897                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PVLB_22260
Enzymes [BR:psv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PVLB_22260
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PVLB_22260
    1.1.1.-  
     PVLB_22260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGZ37231
Position
4913474..4914562
Genome map
AA seq 362 aa AA seqDB search
MNDLSHTHMRAAVWHGRHDIRVEQVPLPADPPPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGEIAKLGEGVEGYAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAERVNVPANLLYRLPQGFPREAGALIEPLAVGMHAVKKAGSLL
GQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEVGASVVLDPSQCDALAE
IRALTGGLGADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEKQV
IGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVELGFEELVNNKEQNVKIIVSPG
GH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacctgagccacacccatatgcgcgccgccgtctggcatggccgccatgacatc
cgtgtcgaacaggtccccctgcctgccgacccgcctcctggctgggtgcaaatcaaggtg
gactggtgcggcatctgtggttccgatctacacgaatacgtggcgggcccagtgttcatc
ccggtcgaggcgccgcatcctctgaccggcatccagggccagtgcatcctcggccacgag
ttctgcggtgaaatcgccaagctcggcgagggagtcgaaggctatgccgtgggcgacccg
gtggcggcggatgcctgccagcattgcgggacctgctactactgcacccatggcctgtac
aacatctgcgagcgcctggccttcaccgggcttatgaacaacggtgccttcgccgaacgg
gtcaatgtgcccgccaacttgctgtatcggttgccacagggcttcccacgggaggccggg
gcactgatcgagccgttggcggtgggcatgcacgcggtgaagaaggccggcagcctgctg
ggacagaacgtggtggtggtaggcgcaggcaccatcggcctttgcaccatcatgtgcgcc
aaggctgccggtgcggctcaggtgatcgcgctggaaatgtcctcggcacgcaaagccaag
gccaaggaagtgggagccagcgtggtgctcgaccccagccagtgcgatgccctggccgag
attcgcgcgctcactggcgggcttggcgccgatgtgagcttcgagtgcatcggcaacaag
cacacggccaagctggccatcgatgccattcgcaaggccggtaagtgcgtgttggtgggt
attttcgaggagcccagcgagttcaacttcttcgaactggtgtccaccgagaaacaggtg
atcggggcattggcctacaatggcgagttcgctgatgtgatcgcattcattgccgatggg
cgtctggatattcgaccgctggtgactgggcgaatcgggctggagcaaattgtcgagctc
ggcttcgaagaattggtgaacaacaaggagcagaacgtgaagatcattgtttcaccgggc
gggcattag

DBGET integrated database retrieval system