KEGG   Pseudomonas sp. VLB120: PVLB_22535Help
Entry
PVLB_22535        CDS       T02897                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00250  Alanine, aspartate and glutamate metabolism
psv00310  Lysine degradation
psv00650  Butanoate metabolism
psv01100  Metabolic pathways
psv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PVLB_22535
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PVLB_22535
   00310 Lysine degradation
    PVLB_22535
Enzymes [BR:psv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PVLB_22535
    2.6.1.48  5-aminovalerate transaminase
     PVLB_22535
Amino acid related enzymes [BR:psv01007]
 Aminotransferase (transaminase)
  Class III
   PVLB_22535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGZ37286
Position
complement(4972875..4974152)
Genome map
AA seq 425 aa AA seqDB search
MNTNQSLQQRRLAAIPRGVGQIHQIYAERAENATVWDVEGREYLDFAGGIAVLNTGHLHP
KVMAAVQAQLAKLTHTCFHVFGYEPYVALAEKINQRVPGDFEKKTLLVTTGAEAVENAIK
IARAATGRQGVIAFTGAYHGRTHYTLSLTGKVVPYSAGMGLMPGGIYRAQYPNAVHGVSS
DDAIASVERIFKNDAAPTDIAAIILEPVQGEGGFNVAPKDFLARLRALCDEHGIVLIADE
VQTGAGRTGTFFAMEQLGVAADLTTFAKSIAGGFPLAGVCGRAEIMDAVAPGGLGGTYAG
SPVSCAAALAVLEAFDDEKLLERAQAVGEILTSGLRAIGERHNSLVDVRNLGAMVAVELF
EGGDLSKPAADLTAKVVAKARDKGLILLSCGTYYNVLRILVPLTVSDADLQRGLALIGEC
FDELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaccagagcctgcaacaacgccgcctggccgccattccacgtggcgtcggg
caaatccaccagatctacgccgagcgtgccgagaacgccaccgtgtgggacgtcgagggc
cgagagtacctggacttcgccggcggtatcgcggtgctcaataccggccacctgcacccg
aaagtcatggcagccgtccaggcgcagctggccaagctgacccacacctgcttccacgtc
tttggctacgagccctacgtggccctggccgagaagatcaaccagcgcgtgccgggcgac
ttcgagaaaaagaccttgctggtgaccaccggcgccgaagcggtggagaacgccatcaag
atcgcccgtgccgccactggccgccagggtgtgatcgccttcaccggcgcctaccatggg
cgtacgcactacaccctgagcctgaccggcaaggtcgtgccgtactctgcgggcatgggc
ctgatgccaggtggcatctaccgtgcccagtacccgaacgcggtgcatggcgtgagcagc
gatgacgccatcgccagcgtcgaacgcatcttcaagaacgacgccgcgccgactgacatc
gccgcgatcattctcgaaccggtccagggcgaaggtggtttcaacgtcgcgccgaaagac
ttcctggcccgtctgcgcgccctgtgcgacgagcacggcatcgtgctgatcgccgacgaa
gtgcagaccggtgctggtcgtaccggtaccttcttcgccatggagcaactgggcgtcgcc
gccgacctgaccaccttcgccaagtccatcgccggtggtttcccgctggctggtgtgtgc
ggccgtgccgagatcatggatgcggtggctcccggtggcctgggcgggacctacgccggt
agcccagtctcctgcgccgctgccctggccgtgctggaagccttcgacgacgagaaactg
ctggagcgggcccaggcggtcggtgaaatcctcaccagcggcctgcgcgccatcggcgag
cgtcacaacagcctggtggatgtgcgcaacctgggtgccatggtcgccgtagagttgttc
gagggcggtgacctgagcaagcctgcggccgatctgactgccaaggtggtggccaaggcc
cgtgacaaagggctgatcctgctgtcgtgcggcacctattacaacgtcttgcgcattttg
gttccgctgaccgtcagcgacgcggacttgcagcgcggtctggccttgatcggcgagtgc
ttcgacgagctcgcctga

DBGET integrated database retrieval system