KEGG   Pseudomonas cremoricolorata: LK03_14335Help
Entry
LK03_14335        CDS       T03354                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psw  Pseudomonas cremoricolorata
Pathway
psw00071  Fatty acid degradation
psw00072  Synthesis and degradation of ketone bodies
psw00280  Valine, leucine and isoleucine degradation
psw00310  Lysine degradation
psw00362  Benzoate degradation
psw00380  Tryptophan metabolism
psw00620  Pyruvate metabolism
psw00630  Glyoxylate and dicarboxylate metabolism
psw00640  Propanoate metabolism
psw00650  Butanoate metabolism
psw00900  Terpenoid backbone biosynthesis
psw01100  Metabolic pathways
psw01110  Biosynthesis of secondary metabolites
psw01120  Microbial metabolism in diverse environments
psw01130  Biosynthesis of antibiotics
psw01200  Carbon metabolism
psw01212  Fatty acid metabolism
psw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LK03_14335
   00630 Glyoxylate and dicarboxylate metabolism
    LK03_14335
   00640 Propanoate metabolism
    LK03_14335
   00650 Butanoate metabolism
    LK03_14335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LK03_14335
   00072 Synthesis and degradation of ketone bodies
    LK03_14335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LK03_14335
   00310 Lysine degradation
    LK03_14335
   00380 Tryptophan metabolism
    LK03_14335
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LK03_14335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LK03_14335
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LK03_14335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psw04147]
    LK03_14335
Enzymes [BR:psw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LK03_14335
Exosome [BR:psw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LK03_14335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIR90401
UniProt: A0A089WP94
Position
3159961..3161151
Genome map
AA seq 396 aa AA seqDB search
MTLASDPIVIVSAVRTPMGGLQGELKSLSAPQLGAAAIGAALERGGVEPEAVDQVLFGCV
LSAGLGQAPARQAALGAGLAAQTTCTTLNKMCGSGMEALILAHDLLLAGSADVVVAGGME
SMSNAPYLLEKARAGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAQAHDFSRQDQ
DDFAIASLTRAQLAISEGRFADEIVPVQVTEARQTRMVSDDEQPPKARLDKIPQLRPAFR
DGGTVTAANASSISDGAAALLLMRRSEAERRGLKPLAVIHGHAAFADQPALFPTAPIGAI
EKLMQRTGWSLDQVDLFEINEAFAVVTLAAMKQLQLPHDKVNVNGGACALGHPIGASGAR
ILVTLIAALRQRNLRRGVAAICIGGGEATAVALQCL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgctagcgaccctatcgtcatcgtcagcgccgtgcgcacgcccatgggcggc
ctgcagggcgagctcaaatccctcagtgctccgcaactgggtgctgccgccatcggcgct
gcgctcgagcgcggtggcgtcgagccagaggcggtcgatcaggtgctgttcggctgtgtg
ctgtccgcagggctcggtcaggcacctgcgcggcaggctgcgctgggcgccggacttgcg
gcgcaaaccacctgtaccaccctgaacaagatgtgtggctcgggcatggaggcgctgatc
ctcgcccacgacctgctgctggcaggctctgccgacgtggtggtcgccggcggcatggaa
agcatgagcaacgcgccctacctgttggaaaaggcccgcgcgggttaccgcatgggccac
ggccaggtgctcgatcacatgtttctcgacggcctggaagatgcctacgacaagggccgc
ctgatgggcaccttcgccgaagactgtgcccaggcccatgacttcagtcgtcaggatcag
gacgatttcgccattgcctcactgacccgcgcgcagttggccatcagcgaagggcgcttc
gccgacgagatcgtcccggtgcaggtcaccgaagcccgccagacccgtatggtcagcgat
gacgagcaaccgcccaaagcgcgcctggataaaatcccgcagctgcgcccggctttccgc
gacggtggtacggtgaccgcggccaatgccagctccatttccgatggcgctgcagccttg
ctgctgatgcgacgctccgaagctgagcgccgcggcctcaagccgctggcagtgattcac
ggccacgcggcgttcgccgaccaaccggcgctgttccccaccgcacccattggcgccatc
gaaaaactcatgcagcgcaccggctggagcctcgatcaggtcgatctgttcgaaatcaac
gaagccttcgccgtggtcacgctggccgcgatgaagcagctgcagctgccccacgacaag
gtcaacgtcaacggcggcgcctgcgcgctgggccatcctattggcgcttcgggggcgcgg
attctggtcacgctgatcgccgcgctgcgtcaacgcaacctgcgccgcggggtcgcggcg
atctgcatcggcggtggcgaggccactgccgttgcccttcaatgcctgtga

DBGET integrated database retrieval system