KEGG   Pseudomonas cremoricolorata: LK03_19175Help
Entry
LK03_19175        CDS       T03354                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
psw  Pseudomonas cremoricolorata
Pathway
psw00350  Tyrosine metabolism
psw00360  Phenylalanine metabolism
psw00380  Tryptophan metabolism
psw01100  Metabolic pathways
psw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LK03_19175
   00360 Phenylalanine metabolism
    LK03_19175
   00380 Tryptophan metabolism
    LK03_19175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psw04147]
    LK03_19175
Enzymes [BR:psw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     LK03_19175
    4.1.1.105  L-tryptophan decarboxylase
     LK03_19175
Exosome [BR:psw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LK03_19175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF1148
Motif
Other DBs
NCBI-ProteinID: AIR91257
UniProt: A0A089WXB1
Position
complement(4149372..4150781)
Genome map
AA seq 469 aa AA seqDB search
MTPEDFRRHGHQLIDLIADYRQSVEQRPVMAQVAPGYLKAALPSAAPQHGEPFASLLDDV
QRLLMPGLSHWQHPQFYGYFPSNASLPSVLGDMLSTGLGVLGLSWQSSPALSELEETTLD
WLRQLFGLSSQWSGVIQDTASTSTLVALICARERASGYALARGGVQAQAAPLIVYASAHA
HSSVDKAALLAGFGRDNIRLIATDEHFAMRPAALQAAIADDLARGNQPCAIVATCGTTAT
TALDPLTPVGQIAQAHGLWLHVDAAMAGSAMILPECRWMWEGIELADSLVVNAHKWLGVA
FDCSLYYVRDPQHLIRVMSTNPSYLQSAVDAEVKNLRDWGIPLGRRFRALKLWFLLRSEG
VEALQQRLRRDLDNARWLAEQVAASPDWQLLAPVHLQTLCLRHCPPGVEGAALEQHTRDW
AQRLNDSGQAYVTPAQLDGQWMVRVSIGALPTEREHVAQLWTALQAVVR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaagacttccgccgccatggccaccaactgatcgacctgatcgccgactac
cgccagagcgtagagcagcgcccggtcatggcccaggtcgcgcccggctacctcaaggca
gcgttgcccagcgccgcgccgcagcacggcgagccattcgccagcctgctggacgatgtt
cagcgcttgctgatgccggggctgtcgcattggcagcatccgcagttctacggctacttc
ccctccaacgccagcctgccttcggtgctgggcgacatgctcagcaccggcctgggcgtg
ctcggcctgtcatggcaatccagcccggcgctgagcgagctggaagaaaccaccctcgac
tggctgcgccaactgttcggcctgtcgagccagtggagcggggtgattcaggacaccgcc
tcgaccagcacgctggtggcgctgatctgcgcccgggaacgggccagcggctatgccctg
gcgcgcggcggcgtgcaagcgcaggcggcgccgctgatcgtctacgccagcgcccacgcc
cacagctcggtagacaaggccgcgctgctggcaggctttgggcgcgacaacattcgcctg
atcgccaccgacgaacacttcgccatgcgccccgcggccttgcaggcggccatcgccgac
gacctggcccggggcaatcagccctgcgccatcgtcgccacctgtggcaccaccgccacc
accgcgctcgacccgctgacgccagtggggcagatcgcccaggcccatggcctgtggctg
cacgtcgatgcggccatggccggctcagcgatgatcctgcccgaatgccgctggatgtgg
gagggtatcgagctggccgactcgctggtggtcaatgcgcacaagtggctgggggtggcc
ttcgactgctcgttgtactacgtccgcgatccgcagcacctgattcgggtgatgagcacc
aatcccagctacctgcaatcggcagtggatgccgaggtgaagaacctgcgtgactggggc
attcccctgggccggcgtttccgcgctttgaagctgtggttcctgctgcgcagcgaaggc
gtcgaagcgctgcagcaacgtttgcgccgtgacctggacaacgcccgctggctggccgag
caggtcgcggctagccctgactggcagctgcttgccccggtgcacttgcagaccctgtgt
ctgcgccattgcccgcctggcgtcgagggtgcggcgctggagcagcacacccgcgactgg
gcgcaaaggctcaacgacagcggccaggcctatgtgaccccggcgcagctcgacgggcag
tggatggtgcgggtgtcgatcggcgcgctgcccaccgagcgcgagcatgtcgcgcagctg
tggacggcgctgcaagcggtggtgcgctga

DBGET integrated database retrieval system