KEGG   Paenibacillus swuensis: SY83_05900Help
Entry
SY83_05900        CDS       T04884                                 

Gene name
argS
Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SY83_05900 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pswu01007]
    SY83_05900 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pswu03016]
    SY83_05900 (argS)
   03029 Mitochondrial biogenesis [BR:pswu03029]
    SY83_05900 (argS)
Enzymes [BR:pswu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     SY83_05900 (argS)
Amino acid related enzymes [BR:pswu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SY83_05900 (argS)
Transfer RNA biogenesis [BR:pswu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SY83_05900 (argS)
 Prokaryotic Type
   Other AARSs
    SY83_05900 (argS)
Mitochondrial biogenesis [BR:pswu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SY83_05900 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1 tRNA-synt_1g tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ANE45901
UniProt: A0A172TFT5
Position
complement(1379040..1380764)
Genome map
AA seq 574 aa AA seqDB search
MSALEQMKQSLKDAIAAAISVSGIVEAGTSVEVALEVPKEKAHGDFSTNAAMQLTKLAKK
NPRQIAESILEHLDKSSAGIEKAEIAGPGFINFFMDRSYLYNVLQEVAEAQKNYGRVQMG
EGQRVQMEFVSANPTGSLHLGHARGAAVGDALCNVLDFAGYEVTREYYINDAGNQVMNLA
KSIEARYLQALGQEVDMPEDGYHGEDIKGFAKDLIAEKGNVIADMPEEERLEFFRTYGLE
KELNKIKRDLGRFGVHFQEWFSETSLYTSGQVIEALDDLKAKGQTFEDGGATWLRTTDYG
DDKDRVLIKNDGSYTYLTPDIAYHKTKYARGYDQIINIWGADHHGYIPRMKAAMSALGND
PDKLIVLIAQMVSLFQNGEKVKMSKRTGKAVTMEDLMDEVGVDAIRYFFTMRSMDSHLDF
DMDLAISTSNENPVFYVQYAHARICSIFRKAEEQGVQLLPLSEVNLHALTADAEYDLLLK
MAVLPEEIAVAAQGFAPHRLVRYVYELAGQLHSYYKAHKAITDDQEQTQARLALLDAVRV
VIRNVLGLIGVSAPDQMTNSTAETDTEEERNTQH
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattggaacaaatgaaacaaagcttgaaagatgctattgctgcggctatttcc
gtatcaggcatcgtggaagccggaacgtcggtggaagttgcgctggaagtgccgaaggag
aaggcgcacggcgatttctccacgaacgcggccatgcaactgacaaagctggcgaagaag
aatcccagacagattgccgagagcattttggaacacttggataagtcttcggcaggaatc
gagaaggcggaaattgccggacctggatttattaacttctttatggaccgcagctacctg
tacaacgttttgcaggaagtcgcggaggcacaaaagaattacggccgtgtccaaatgggc
gaagggcaacgcgtacagatggagtttgtcagcgcgaatccgaccggcagcttgcacttg
ggccatgcccgcggggcggcggtaggcgacgcgttatgcaacgtgcttgatttcgcgggc
tatgaagttacccgggagtattacattaacgatgcgggcaatcaggtgatgaacctggcg
aaatccattgaggcgcgttacctgcaagcgcttggccaggaagtggatatgcctgaggac
ggttatcacggggaggacatcaagggtttcgccaaggacctgatcgccgagaagggtaat
gtcatcgccgatatgcctgaagaagagcgtcttgagttctttagaacatacggtttagag
aaagaattgaataagattaaacgggaccttggccggttcggcgtgcatttccaggagtgg
ttcagtgaaacatcactttacacgtccgggcaagtcattgaagcgctggatgatctgaag
gcgaaaggtcagactttcgaggacggcggagcgacttggttgcgcacgaccgattacggg
gatgacaaagaccgtgttctgatcaagaacgacggcagttatacgtatttgacgccggat
attgcttaccacaaaaccaagtatgcccgcggttacgatcaaatcatcaacatctggggc
gcggatcatcatgggtacattccgcggatgaaagcggcgatgtcggcgctggggaacgac
ccggataaactcatcgtgctgatcgcgcaaatggtcagcctgttccagaacggcgagaaa
gtcaagatgtccaagcggacggggaaagccgtcacgatggaagatcttatggatgaagtc
ggcgtggatgccatccgctacttcttcacgatgcgcagcatggattctcatctggatttc
gacatggatttggcgatttccacttccaacgagaatccggtgttctacgtgcaatacgcg
catgcccggatttgcagtattttccgcaaagcggaggagcaaggcgttcaattgcttccg
cttagcgaagtgaatctgcatgcgttaaccgctgacgccgagtatgacttgctgcttaag
atggccgtgctgcctgaagagattgccgttgccgcgcaaggttttgcgcctcatcgcctc
gttcgttatgtatacgaattggcgggacaacttcatagctattacaaagcgcacaaggcg
attacggatgaccaagagcagacgcaagcccgactggccttgctggatgccgtgcgagtt
gtgattcgtaacgttcttggcttgatcggcgtatccgcgccggatcagatgacgaatagt
acggcggaaacagacaccgaagaagagcggaacacccaacactaa

DBGET integrated database retrieval system