KEGG   Paenibacillus swuensis: SY83_05990
Entry
SY83_05990        CDS       T04884                                 

Definition
(GenBank) hypothetical protein
  KO
K18910  D-psicose/D-tagatose/L-ribulose 3-epimerase [EC:5.1.3.30 5.1.3.31]
Organism
pswu  Paenibacillus swuensis
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SY83_05990
Enzymes [BR:pswu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.30  D-psicose 3-epimerase
     SY83_05990
    5.1.3.31  D-tagatose 3-epimerase
     SY83_05990
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: ANE45915
UniProt: A0A172TFS2
Position
complement(1399488..1400294)
AA seq 268 aa
MLLTCKENMIQGLNMSEVCRKVKDAGFDGIDLMGGVLKQQLIEVKSALRDTGLVSAAVYG
QLGKAGSSLIDLTAAARVQALDLFKERIELAAEVGAGRLIFVPRFGKSELRPEASDWVLI
TMLDELAEWAAGIPVTLIMEPLNRRESEFLHDPLKGLALVSEVGRPNVKTMIDTYHMFVE
QQDVTDVTAQLGSALGLVHLSDSERKLPGQGVVDFQQVLHVLHKVRYDGPLGFECKEAGL
TELHTSVAYIKELLADVQAAARSKEKVQ
NT seq 807 nt   +upstreamnt  +downstreamnt
atgttactgacttgcaaggaaaatatgattcagggtctgaatatgagcgaggtttgcagg
aaagtgaaggacgcgggttttgatggcatcgatcttatgggaggggtgctcaagcaacag
ttgatcgaggtgaaaagcgcgttgcgggataccggactcgtgtctgccgcagtctacggg
caattgggaaaggcgggcagctcattaatcgatttgacggcggctgcgcgcgttcaagct
ctggatttgttcaaagagcgtatagagctggctgccgaggtcggagccggacgattgatc
tttgtaccgcgtttcggtaagtcggaactgaggccggaggcatccgattgggtgctcatt
acgatgctggatgagttggccgagtgggctgcggggatccccgtaacgctcatcatggaa
ccgttaaaccgcagggaaagcgagtttttgcacgatcctctgaagggcttggctcttgta
agcgaggtcgggcgccccaatgtgaagacgatgattgatacgtatcacatgtttgtggag
cagcaggatgtgacggatgttaccgctcagttaggctcagcactcgggctcgtacatctg
tccgattccgagcgcaagttgcctggacagggtgtagttgatttccagcaggttcttcat
gtgcttcataaggtccgttacgacggtccgcttggatttgagtgcaaggaagcggggttg
accgaacttcataccagtgttgcatatattaaggagctgttggccgatgtgcaggccgca
gcccgttctaaggagaaggttcaatga

DBGET integrated database retrieval system