KEGG   Paenibacillus swuensis: SY83_11440Help
Entry
SY83_11440        CDS       T04884                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pswu  Paenibacillus swuensis
Pathway
pswu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SY83_11440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pswu03011]
    SY83_11440
Ribosome [BR:pswu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SY83_11440
  Bacteria
    SY83_11440
  Archaea
    SY83_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANE46788
UniProt: A0A172TIB4
Position
2608711..2609043
Genome map
AA seq 110 aa AA seqDB search
MQAKANANYVRIAPRKVQLVIDLIRGKAVGEAIAILRHTPKSASPVVEKILNSAIANAEH
NYNLDTSKLVVSQAYVNHGPIMKRFRPRAMGRASAIHKRTSHITLVVSEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagcaaacgcgaattacgttcgaattgctcctcgtaaagttcagctcgtt
atcgacttgatcagaggtaaggcagtaggtgaagcgatcgcaatccttcgtcatacacct
aaatccgcttcgcctgtagttgaaaagattctaaattccgcaatcgcgaacgcagaacac
aactacaacctggatactagcaaattggtcgttagccaagcatatgtaaaccatggtccg
attatgaagagattccgccctcgtgcgatgggtcgtgcaagtgcgatacacaaaagaaca
agccacattacattagtggtatccgagaaataa

DBGET integrated database retrieval system