KEGG   Paenibacillus swuensis: SY83_18350Help
Entry
SY83_18350        CDS       T04884                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00430  Taurine and hypotaurine metabolism
pswu00620  Pyruvate metabolism
pswu00640  Propanoate metabolism
pswu00680  Methane metabolism
pswu01100  Metabolic pathways
pswu01120  Microbial metabolism in diverse environments
pswu01200  Carbon metabolism
Module
pswu_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pswu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SY83_18350
   00640 Propanoate metabolism
    SY83_18350
  09102 Energy metabolism
   00680 Methane metabolism
    SY83_18350
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SY83_18350
Enzymes [BR:pswu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SY83_18350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ANE47928
UniProt: A0A172TLL6
Position
complement(4101646..4102854)
Genome map
AA seq 402 aa AA seqDB search
MKVLVINAGSSSLKYQLYDMTDESVLAKGRVERIGMDSAILVHEPTDKQDVTEVSEILEH
RTAIRKVVDMLTHPEHGVLGSINEIDAVGHRIVHGGETFSSSVVVTPEVKKEIKRLFDLA
PLHNPAHMMGIEAVELNMPGVPQAVVFDTAFHQTMPAKSYMYAIPRVLYTKHKVRRYGFH
GTSHFYVSRQAAEFLERPLEELKVVTCHIGNGGSVTAILDGKSFDTSMGMTPLEGLMMGT
RSGDLDPAIVPFVMGKEDLTINEVNSMLNKHSGLQAISGISSDMREIETAMNEGDRNATL
AFEMYEYRIRKYIGGYAAAMNGIDVLVFTAGVGENASNVRAKVCEGLSFLGIEMDEEANK
IRSGDNRRISTANSKVQVLVIPTNEELVIARDTYRLIDEAGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttctagtcattaacgcggggagctcctcgcttaaatatcaactgtacgatatg
acggatgagtctgttctggctaaaggccgcgtagagcgaatcggtatggattcggcaata
cttgtacatgaaccgacggacaagcaagatgttacggaagtcagcgaaattctggaacac
cgcacggcaatccgtaaagtggtcgatatgttgacacacccggaacatggtgtcctaggt
tctatcaatgaaatcgacgctgtaggtcaccgcatcgtgcatggcggcgaaacgttctcc
tcctccgttgttgttacaccggaagtcaagaaagaaatcaagcgcctgttcgacttggcg
ccgttgcataacccggctcacatgatgggtatcgaggctgttgaactgaacatgccgggt
gttcctcaggccgtggtatttgatacggcgttccatcagacgatgcccgccaagtcgtat
atgtacgcgattccccgcgtgctttataccaagcataaagtccgccgttacggctttcac
ggcacctctcatttttatgtgagccgccaagccgcggagtttctggaacgccctctggag
gagctgaaagtcgtgacttgtcatatcggtaacggaggcagcgtgacagcgattctggac
ggcaagtcttttgatacaagcatgggtatgacgccgttggaaggattaatgatgggtacc
cgttctggtgatctggatccggcgattgtaccttttgttatgggcaaagaagatttaacg
attaatgaagtcaattccatgctgaacaagcatagcggtttgcaagcgattagcggcatc
tccagcgatatgagggaaatcgaaacggccatgaacgaaggggaccggaatgcaaccctc
gcattcgagatgtacgaataccgtattcggaaatatattggcggttatgccgcagctatg
aacggaatagacgtgctcgtctttactgcgggcgttggcgagaatgcgtcgaatgtccgg
gctaaagtatgcgaaggcttaagcttcctaggaatagaaatggatgaagaagcgaacaag
attcgatcaggcgacaaccgtcgtatttccacggcgaattccaaagttcaggtattggtg
atccctacgaatgaagagctggttattgcccgggacacgtatcgtctcattgatgaagcg
ggtaagtag

DBGET integrated database retrieval system