KEGG   Providencia stuartii ATCC 33672: DR96_1486Help
Entry
DR96_1486         CDS       T03282                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00270  Cysteine and methionine metabolism
psx00920  Sulfur metabolism
psx01100  Metabolic pathways
psx01110  Biosynthesis of secondary metabolites
psx01130  Biosynthesis of antibiotics
psx01230  Biosynthesis of amino acids
Module
psx_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DR96_1486 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DR96_1486 (metA)
Enzymes [BR:psx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     DR96_1486 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     DR96_1486 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AIN64139
UniProt: A0A506Y401
Position
1623048..1623977
Genome map
AA seq 309 aa AA seqDB search
MPIRLPDELPAVNFLREENVFVMTTTRASLQEIRPLKVLLLNLMPKKIETENQFLRLLSN
TPLQVDIQLLRIDQRESKNTPAEHLNTFYCDFEDIQDQNFDGLIVTGAPLGLVEFCDVAY
WQQIEKVIHWAKDHVTSTLFVCWAVQAALKVLYDLPKWTREEKLSGIYQHDTLEPFALLT
RGFDGSFYAPHSRYADFPESLIRKHTDLDILASSQEAGAYLFASKDKRLVFVTGHPEYDA
DTLAQEYWRDVDAGISPNIPCNYFRENNPEKDPIITWRSHGHLLFSNWLNYYVYQITPFD
LSHMQPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcgtttacctgatgagttgccagcggtaaatttcttacgagaggagaatgtt
tttgtcatgacaacgacaagagcaagccttcaggagatccgtcccttgaaagtgttacta
ctcaatttgatgcctaagaaaattgaaactgaaaatcaatttttacgtttactgtcgaac
acaccgctacaagttgatattcagttactgcgaattgatcagcgtgaatctaaaaatacg
cctgcggaacatctgaataccttttattgtgactttgaggatatccaagaccagaatttt
gatggattgattgtgactggtgctcctttaggtttagtggagttttgtgatgttgcttat
tggcagcaaatagaaaaagtgattcattgggcgaaagatcatgtgacctcgactctattt
gtttgctgggcggtgcaggctgcattgaaagtgctttatgatttacctaaatggacacgg
gaagaaaagctatctggtatttatcagcatgatacgcttgagccttttgccctattaacc
cgaggatttgatggatctttttatgcgcctcattcacgctatgctgacttccctgaatca
ttgatccgcaaacatacggatttggatatattagctagttcacaagaagcgggggcttat
ctatttgcatctaaagataagcgattagtttttgttacaggtcatccagaatacgatgcg
gataccctcgctcaagaatattggcgcgatgttgatgctggaatttcaccaaatatcccc
tgtaattattttagggaaaataatccggaaaaggatcccattattacttggcgtagtcat
gggcacctacttttctcaaattggttaaattattatgtgtatcagatcacacctttcgat
cttagtcatatgcagccgacgttagattaa

DBGET integrated database retrieval system