KEGG   Providencia stuartii ATCC 33672: DR96_3097Help
Entry
DR96_3097         CDS       T03282                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00260  Glycine, serine and threonine metabolism
psx01100  Metabolic pathways
psx01110  Biosynthesis of secondary metabolites
psx01120  Microbial metabolism in diverse environments
psx01130  Biosynthesis of antibiotics
psx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DR96_3097
Enzymes [BR:psx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DR96_3097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIN64283
Position
3358069..3359094
Genome map
AA seq 341 aa AA seqDB search
MYSFQNDYNEIAHPAVMKALNDLVGSRFDGYGIDKYTQQIAEKIKSRIGRTDADIHFFNG
GTITNLTAISHVLRPHQAVIAVDSGHIATHETGAIEATGHKVLTVSSDSGKLEPKHIQAV
LAEHSDEHAVQPKLVYISNSTEIGTVYRKHELQALREACDQYGLWLFMDGARLASGLMSN
KSDLTIEEIAQMTDMFYIGGTKIGAFSAEVLVLLNPALKSDFRYTLKQKGALQAKGWLLA
AQFDALFSDDLFFQLGAYVNDKATQLVNLFEEKGFGFLAPPESNQIFVVLPNELATKLMS
HYVLRKICEPEAGKSCLRLCTSWSTTQEDVDRFISTFNSLI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtacagttttcaaaatgattataatgaaatagcacaccccgcagtcatgaaagcgcta
aatgatttagttggaagccgttttgatggttatggaatagataaatatactcaacaaatt
gcggagaaaattaagtctagaatagggcgtacagacgcagatattcacttttttaatggt
ggtacgatcaccaatttaacagccatttcccatgttttgcgtccacatcaagccgtaatt
gccgtcgattctgggcatattgcgacccatgaaacaggggctattgaagcaacaggccat
aaggtcctcaccgttagctcagactccggtaaacttgaaccaaagcatattcaggcggta
cttgccgagcatagtgatgagcatgcagtacaacccaaattagtctatatcagtaactca
acagaaataggtactgtatatcgtaaacatgaacttcaggctctaagggaggcctgtgat
caatatggtttgtggctatttatggatggggcgcgtttagcatctggattaatgtcgaac
aagagtgatttaacaatcgaagaaatcgctcaaatgacggatatgttctatatcggtgga
acaaaaataggcgctttttcagcagaagtattggtgcttttaaatcctgcacttaagtct
gatttccgctataccctaaaacaaaaaggcgctttgcaagcaaagggttggttgttggcg
gcacaatttgatgcactgtttagcgatgacctattttttcaattgggggcatatgttaat
gataaagcgacacagctagtgaacctttttgaggaaaaaggttttggtttccttgcacca
ccagaatctaatcaaatttttgtggttttacctaacgaacttgcgactaaattgatgtct
cattacgtattgcgtaagatttgtgagcctgaggcagggaaaagctgtttgcgcctttgt
acttcctggtcaacaactcaggaagatgttgatagatttatttcaacatttaactcatta
atttaa

DBGET integrated database retrieval system