KEGG   Providencia stuartii ATCC 33672: DR96_3274Help
Entry
DR96_3274         CDS       T03282                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx00010  Glycolysis / Gluconeogenesis
psx00071  Fatty acid degradation
psx00350  Tyrosine metabolism
psx00620  Pyruvate metabolism
psx00625  Chloroalkane and chloroalkene degradation
psx00626  Naphthalene degradation
psx00650  Butanoate metabolism
psx01100  Metabolic pathways
psx01110  Biosynthesis of secondary metabolites
psx01120  Microbial metabolism in diverse environments
psx01130  Biosynthesis of antibiotics
psx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR96_3274 (adhE)
   00620 Pyruvate metabolism
    DR96_3274 (adhE)
   00650 Butanoate metabolism
    DR96_3274 (adhE)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DR96_3274 (adhE)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DR96_3274 (adhE)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DR96_3274 (adhE)
   00626 Naphthalene degradation
    DR96_3274 (adhE)
Enzymes [BR:psx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DR96_3274 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     DR96_3274 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AIN63704
UniProt: A0A379GMC2
Position
3539053..3541713
Genome map
AA seq 886 aa AA seqDB search
MSVTNVTELNDLVARVKKAQREFANFSQEQVDRIFRAAALAAADARIPLAKLAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDPTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKNATNKAAEIVLKAAIEAGAPKDIIGWIDAPSVELSNA
LMHHEDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVVVVDEIYNQVRERFATHGGYILQGKELKAVQDVILKNGSLNAAIVGQT
AYKIAEMAGVTVPVTTKILIGEVKVIADSEPFAHEKLSPLLAMYRAKNFEEAVDKAEQLV
EMGGIGHTSCLYTDQDNQAERVNYFGVKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPNSIYFRRGCLPIALEEIATDGAK
RAFIVTDGYLFNNGYVEEVVNVLKKHHIETDVFFEVEADPTLTVVRKGAAQMNAFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIHRFPKMGVKAKLVAITTTSG
TGSEVTPFAVVTDDKTGQKYPLADYALTPNMAIVDANLVMNMPKSLTAFGGLDAVTHAME
AYVSVLANEYSDGQALQALSLLKEYLPTSYHEGATNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLTKSSDRTDAKIEKLLAWLEEIKADLGIPKSIREAGVPEADFLARVDKLSEDAFDDQ
CTGANPRYPLISELKQLLLDSYYGREFTEQTSTTTAAKVEKKSSKK
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaactaatgttaccgaactcaatgacctcgttgctcgtgtcaaaaaagctcag
cgtgaattcgctaacttctctcaagagcaagttgaccgcattttccgcgcagcagcgctt
gcagcagcagacgcacggatcccgctcgctaaacttgctgtagaagaatcaggtatgggt
attgttgaagataaggtgatcaaaaatcactttgcctctgaatatatttataatgcctat
aaagacgaaaaaacctgtggcgtgctttctgaagacccaacttttggaacaattactatc
gctgaacctatcggtattatctgtggtatcgttccaaccactaacccaacctcaactgcc
atttttaaatctttaattagtttaaaaacgcgtaatgcaattattttttctccgcaccct
cgcgctaaaaatgcaaccaataaagcggcagaaattgttcttaaagcagctatcgaagct
ggtgcaccaaaagatattatcggttggatcgatgcaccatcggtcgaattatctaatgca
ttgatgcatcacgaggatatcaacctgattttagcaacaggtggtcctggtatggtgaaa
gcggcatacagctccggtaaacctgctattggtgtaggcgcaggtaatacaccggttgtt
atcgatgaaacggccgatatcaaacgtgctgtggcgtctatcttgatgtcaaaaaccttc
gataatggcgtcatctgtgcatccgagcaatccgttgttgtcgttgatgaaatttataat
caggttcgtgaacgcttcgcgacccacggtggctatatactgcaaggtaaagagcttaaa
gccgttcaagatgttatcttgaaaaatggtagtctgaacgcagcaattgttggtcaaact
gcatataaaatcgctgaaatggccggtgttactgtacctgtaaccacgaaaatacttatt
ggcgaagtcaaggtaattgcagattcagagccatttgcccacgaaaaattatcgccactc
cttgccatgtatcgcgctaaaaactttgaagaggctgtagacaaagccgagcaattagtc
gaaatggggggtatcggtcacacctcttgtctatatacagaccaagataaccaagctgaa
cgtgttaattacttcggcgtcaaaatgaaaaccgcgcgtatcctcattaatacgcccgct
tcacaagggggtatcggtgacctctataactttaaattagcgccttctctcacacttggt
tgcggttcatggggtggtaactcaatctctgaaaacgttggaccaaaacatttgatcaat
actaaaaccgtggcgaaaagagctgaaaatatgttgtggcataaacttcctaactcaatc
tatttccgtcgcggttgtctccctattgcacttgaagagatcgcaacggatggcgcaaaa
cgtgcatttatcgtcactgatggctatttatttaacaatggctatgttgaagaagtggta
aatgtactgaaaaaacaccatattgaaaccgacgttttctttgaggttgaagctgatcct
acattaacggtcgtccgtaaaggtgccgctcaaatgaacgcctttaaacctgatgtcatt
attgcattaggtggtggctccccaatggacgcggccaaaattatgtgggttatgtacgaa
catccagaaacgcattttgaagaattagcactacgctttatggatatccgtaaacgtatt
caccgtttccctaaaatgggagtgaaagcaaaattagttgcgattacaacgacctcagga
acaggctctgaagttaccccatttgcagtggtaacggatgataaaacaggtcaaaaatac
ccattagcggactatgcactgactccaaatatggctatcgtcgatgcaaaccttgtgatg
aatatgccgaaatcactgaccgcatttggtggtctggatgctgtgactcatgcgatggaa
gcctatgtttctgtattagcgaatgaatactctgatggtcaagcattacaagcgcttagc
ctattaaaagagtacctaccgacgagttatcatgaaggggcaaccaatcctgttgcaaga
gagcgtgtccataacgctgcaaccatcgctgggattgcatttgcaaacgcattcttaggg
gtttgtcactcaatggcccataaattaggctctgagttccacataccacatggattagcg
aatgccttattaattagtaacgtcgttcgttataatgctaacgataacccaactaaacaa
acggcatttagccaatatgaccgtccacaagcacgacgccgttatgctgaaatagccgat
catttaggtttaacaaaatctagcgaccgtaccgatgctaaaattgaaaaactattagca
tggcttgaggaaatcaaagcagatttaggtatccctaaatccatacgtgaagcaggtgtg
cctgaagcagacttcttagcacgcgttgataagctctctgaggatgcatttgacgaccaa
tgtaccggtgcaaaccctcgctatccattaatttctgaattgaaacagctattactggat
tcctattatggacgcgaattcactgaacaaacatccacaacaacagcagcaaaagtggaa
aagaaaagttcaaaaaaatag

DBGET integrated database retrieval system