KEGG   Providencia stuartii ATCC 33672: DR96_3333Help
Entry
DR96_3333         CDS       T03282                                 

Gene name
rlmA
Definition
(GenBank) ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
psx  Providencia stuartii ATCC 33672
Brite
KEGG Orthology (KO) [BR:psx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psx03009]
    DR96_3333 (rlmA)
Enzymes [BR:psx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     DR96_3333 (rlmA)
Ribosome biogenesis [BR:psx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DR96_3333 (rlmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_29 Methyltransf_12 MTS Methyltransf_32 Methyltransf_4 Ubie_methyltran CheR Methyltransf_18 MetW PCMT DUF938 FtsJ Methyltransf_9 AviRa Pox_MCEL PrmA
Motif
Other DBs
NCBI-ProteinID: AIN64108
Position
complement(3595466..3596287)
Genome map
AA seq 273 aa AA seqDB search
MSYQCPLCFSPLKLNNNSWQCSNNHQFDRAKEGYVNLLPVQHKRSKDPGDSAEMMQSRRQ
FLNAGHYDPMRQCVTEKLAQYLSEQSENVLDIGCGEGYYTDYFMQSLIKQRAIKAVFGLD
VSKAAIRYAAKRYPSVNFCVASSHRLPFPEQSIDAIVRIYAPCKAEELARVLQRSGILIT
VTPAPEHLQELKQLIYSEVKLHPIKEEALPQFKLVDETNLKYSMHLTGDEAFALLQMTPF
AWRASVDVKNTLQQSEPKDYTADFLIRVYQLID
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaatgccccctgtgttttagtcctttaaagttgaataataatagttggcag
tgttccaataaccatcaatttgatcgtgcaaaagaaggttatgtgaacttactgccagta
caacataagcgttctaaggatcctggtgacagtgccgaaatgatgcagtctcggcggcaa
tttttaaatgcaggtcattatgatccaatgcgtcaatgtgtgactgagaaattagcgcaa
tacctttctgagcagagtgaaaatgtattagatattggttgtggagaagggtattacact
gactattttatgcaaagcttaataaaacagcgggcaattaaagctgtttttgggttagat
gtatcaaaagccgctattcgttatgcggcaaaacgctatccatcagtcaatttttgtgtt
gcctctagtcaccgtttgcctttccctgaacaaagtattgatgcgattgttcgtatttat
gcaccttgcaaagcggaagaattagctagagttctgcaacgttcgggaatattgattact
gtaacaccagctcctgaacacttacaggaattgaaacagttgatttatagtgaggttaaa
ttacatccaattaaagaagaagccttgccgcaatttaaattagtggatgaaaccaattta
aagtactcaatgcacttaacaggggatgaagcatttgcattattacaaatgacccctttt
gcatggcgagcttctgtggatgttaaaaatacattacaacagtcagaaccaaaagattat
acggctgattttctgatacgggtgtatcaacttattgattaa

DBGET integrated database retrieval system