KEGG   Providencia stuartii ATCC 33672: DR96_910Help
Entry
DR96_910          CDS       T03282                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psx  Providencia stuartii ATCC 33672
Pathway
psx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DR96_910 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psx03011]
    DR96_910 (rplV)
Ribosome [BR:psx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DR96_910 (rplV)
  Bacteria
    DR96_910 (rplV)
  Archaea
    DR96_910 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIN65031
UniProt: A0A1L3IIT8
Position
complement(975292..975624)
Genome map
AA seq 110 aa AA seqDB search
METLAMHRHARSSAQKVRLVADLIRGKKVSQALEILTYTNKKAAGLVKKVLESAIANAEQ
NDGADIDDLKVAKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctatgcatcgccacgctcgttcttctgcccagaaggttcgcttagtt
gccgacctgattcgcggtaagaaagtgtcgcaagctctggaaattctgacctacaccaac
aagaaagctgctggtttagtgaagaaagtacttgaatctgcaattgctaacgcagagcaa
aacgatggcgctgacattgatgacctgaaagttgcgaaaattttcgttgacgaaggtcca
accatgaaacgcatcatgccgcgtgcgaaaggccgtgcagatcgtattcttaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system