KEGG   Psychromonas sp. CNPT3: PCNPT3_02125Help
Entry
PCNPT3_02125      CDS       T02515                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
psy  Psychromonas sp. CNPT3
Brite
KEGG Orthology (KO) [BR:psy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psy03009]
    PCNPT3_02125
Enzymes [BR:psy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PCNPT3_02125
Ribosome biogenesis [BR:psy03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PCNPT3_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AGH80367
UniProt: M4U5H7
Position
497142..498110
Genome map
AA seq 322 aa AA seqDB search
MSQPLHLTAEVTILQLGFRLDKALAALFPDYSRTRIKEWILDDLVKIDDVTVNRPREKVY
TGQQVEVNATLEDEVVFHPQNIPLDIIFEDEHILVINKPAGLVVHPGAGNPDGTVLNALL
HHYPEIVEVPRAGIVHRLDKDTTGLMVIAKTVPAQTHLVTSLQAREITREYDAIAMGCFT
AGGRVEAPIGRDKANRVKMAVATVGGKHAVTHYRVAEKYRAHTRLRLRLETGRTHQIRVH
MSHIGHVLAGDPVYGGRPRPPKGASESLTTTLRAFKRQALHAIMLRLEHPITGEIMEWHA
PVPDDMKELAAVLRADAIFYEQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaccgttacatttaactgcagaagttaccattttgcaactgggatttcgttta
gataaagcactggctgcattatttcctgattattctcgtacgcgcattaaagaatggatc
ttagatgatcttgttaaaattgatgatgttaccgtcaatcgccctcgtgaaaaagtatac
actggccagcaagtagaagtgaatgcaacgttagaagacgaagtggttttccatccgcaa
aatattcctttagacattatttttgaagatgagcatattttggttatcaataaacctgca
ggtttagtggtacaccctggtgcgggtaatccagacggtacggtattaaatgcattgctg
catcattatcctgagattgtcgaagtgccacgtgccggtattgtgcatcgtctcgataaa
gacacgacaggactcatggtcattgctaaaacagtgccagcgcaaacgcatttagtgacg
agcttacaagcacgtgaaattacgcgtgaatatgatgcgatagcaatgggttgctttacg
gcaggcgggcgcgttgaagcgccgattggccgtgataaggctaaccgagttaaaatggcc
gtagcgacagtaggtggtaaacatgcggtgacgcattaccgagttgctgaaaagtatcgc
gcgcacacacgtttacgtttacgtttagagacggggcgtacgcaccaaatccgtgtgcat
atgtcacatattggtcatgtattagcgggagatcctgtctatggtggtcgtcctcgtcca
cctaaaggtgcgagtgagtcgttaacgacgacattacgtgcatttaagcgtcaagcgttg
catgcaatcatgctacgtttagagcatcctatcaccggtgaaataatggaatggcatgca
cctgtaccagacgatatgaaagaactggccgctgtgttacgtgctgatgctatcttttat
gagcaatag

DBGET integrated database retrieval system