KEGG   Psychromonas sp. CNPT3: PCNPT3_02770Help
Entry
PCNPT3_02770      CDS       T02515                                 

Definition
(GenBank) bifunctional cysteine desulfurase/selenocysteine lyase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
psy  Psychromonas sp. CNPT3
Pathway
psy00450  Selenocompound metabolism
psy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PCNPT3_02770
Enzymes [BR:psy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     PCNPT3_02770
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     PCNPT3_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGH80496
UniProt: M4U4H0
Position
661867..663099
Genome map
AA seq 410 aa AA seqDB search
MSYPIEHIRSQFPLLQQSINDQKLVYLDSAATAQKPLSVLKRIDDFYRFENAAVHRGIHQ
LSSNATIMMEAVRDKVRGFINAKTREEIVFVRGATQAINLVASSFGGEHWRAGDEIIITE
MEHHSNIVPWQILAQRLNLKIVVWPIDTQGGLDLSTLGCLLTSKTRLLAVTHVSNVIGTL
NPIGEIIKRCRANNTLTLVDGAQGVMHHKIDVQALDCDFYVFSGHKLYGPTGCGVLYGKY
SLLQSMPPMEGGGAMISVVDLIKGSQFVEAPYRFEAGTPNTSAIIGLGSAIDYIDDIGLD
CIAQHENKLMAYADASLRSIASLKIYGDMPLHLRSGVIAFNLEGIHAFDVGTFLDRYGIA
IRTGHHCAMPLLKHYQQTSMCRMSIALYTEKSEIDALVKGLIRIVRLLGK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcccattgagcatattcgcagccagtttccactgctacaacagtctattaat
gatcaaaaattagtttatttagatagcgctgctacagcgcaaaaacccttgtcggtatta
aagcgtatcgatgatttttatcgttttgaaaatgcagccgtgcaccgaggtattcaccag
ttaagtagtaatgcgaccattatgatggaggcggtgcgcgataaagtacgaggctttatt
aatgccaaaacacgtgaagaaatcgtttttgtacgtggcgctacgcaggcgattaatctg
gttgcctcgagctttggtggtgagcattggcgcgcaggtgatgaaattattattacggaa
atggagcatcactcaaatatcgtgccgtggcaaatattagcgcaacgtttaaatttaaaa
atagtcgtttggcccatcgatacacagggcgggttagatttatcaacattaggctgttta
ttaacctctaaaacacggctattggcagttactcacgtgtctaatgttatcgggacatta
aatccgattggtgaaataattaaacggtgtcgcgccaataatacactgacgttagtcgat
ggcgcgcagggcgtgatgcatcacaaaatagatgtacaggcattagattgtgatttttat
gtgttttcggggcataaactttacggtccaacgggatgcggtgtgctttatggtaaatat
tcattattacaaagtatgcctccgatggagggggggggcgccatgatatctgttgttgat
ctcattaagggaagccaatttgttgaggcgccgtatcggtttgaagccggaacgccaaat
accagtgcgatcattggattgggaagtgccattgattatattgatgacattgggcttgat
tgtattgcgcaacacgaaaataaactcatggcttatgctgatgcttcgctacgatctatt
gcctcgcttaaaatttatggtgatatgccattacatctgcgctctggcgtcatcgctttt
aaccttgaaggtattcatgcgttcgatgttggtacttttttagatcgttatggtattgct
attcgtaccgggcatcactgtgctatgcctttattaaagcactatcagcaaacctcgatg
tgtcgaatgtctattgcactttacactgaaaaatcagaaatagacgctttggtaaagggc
ttaatacgtattgtgcgcttactagggaaataa

DBGET integrated database retrieval system