KEGG   Psychromonas sp. CNPT3: PCNPT3_03820Help
Entry
PCNPT3_03820      CDS       T02515                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
psy  Psychromonas sp. CNPT3
Pathway
psy00270  Cysteine and methionine metabolism
psy00480  Glutathione metabolism
psy01100  Metabolic pathways
Module
psy_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:psy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PCNPT3_03820
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PCNPT3_03820
Enzymes [BR:psy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     PCNPT3_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST Rimk_N Phage_integrase
Motif
Other DBs
NCBI-ProteinID: AGH80706
UniProt: M4U515
Position
complement(917979..918926)
Genome map
AA seq 315 aa AA seqDB search
MSIKIGILMDPIENINIHKDSSFAMLLEAQSRGWELYYITMKDLYLENGRCFVESKKLSV
QRKENDFYQLEAPIDHPLADLDALLMRIDPPFDTEYIYATYLLERAEEEGCLIVNKPQSL
RDANEKLFTAWFNEFTPETLVTRNAKKIREFHQKHRDVILKPLDGMGGASIFRIKENDAN
LGVIIETLTEHESRYCMAQAFIPEITQGDKRILIVDGEPMPYALARIPAKGETRGNLAAG
GRGVAQPLSESDWHIANSIGPKLKEKGLIFVGLDVIGDKITEINVTSPTCIQEIDKAYGT
NIAGKLMDAIEKRVR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaaattggtattttgatggatcccatcgaaaatataaacattcataaagat
tcaagttttgccatgcttttagaagcgcagtcacgtggttgggaactttactatatcacc
atgaaagatctgtacttagaaaatggacgctgttttgtagagagtaaaaagctcagcgta
caacgtaaagaaaatgatttttatcaattagaggctcctattgaccaccctcttgctgat
ttagatgctctgctcatgcgtatagatccaccgtttgatactgaatatatttatgcgacc
tatttactggaacgcgcagaagaagaaggctgtttgatcgtcaacaaacctcaaagttta
cgcgatgcaaatgaaaagttatttactgcgtggtttaatgaatttacacctgaaacatta
gtgactcgtaatgctaaaaaaatccgtgaatttcatcaaaaacatcgtgatgttatttta
aaaccgctcgatggtatgggtggcgcatctattttccgaattaaagaaaatgatgcgaat
ttaggtgtgatcatcgaaacactgactgagcatgaaagtcgttattgtatggcacaggct
tttattcccgaaattacacaaggggataaacgcatcttaattgttgatggtgagccaatg
ccttatgcacttgcgcgtattccagcaaaaggtgaaacacgtggaaacttagctgcggga
ggacgtggcgtagcgcagccattgtctgaatccgattggcatatcgccaactctatcggc
cctaaattaaaagaaaaaggccttatttttgttggtctcgatgtgattggggataaaatt
acggagataaatgtcaccagcccaacctgcattcaagagatagataaagcttacggaaca
aatattgcaggtaaattaatggatgcgattgaaaaacgagtacgataa

DBGET integrated database retrieval system