KEGG   Psychromonas sp. CNPT3: PCNPT3_04880Help
Entry
PCNPT3_04880      CDS       T02515                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psy  Psychromonas sp. CNPT3
Pathway
psy00450  Selenocompound metabolism
psy00970  Aminoacyl-tRNA biosynthesis
psy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PCNPT3_04880
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PCNPT3_04880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psy01007]
    PCNPT3_04880
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psy03016]
    PCNPT3_04880
Enzymes [BR:psy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PCNPT3_04880
Amino acid related enzymes [BR:psy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PCNPT3_04880
Transfer RNA biogenesis [BR:psy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PCNPT3_04880
 Prokaryotic type
   Other AARSs
    PCNPT3_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AGH80918
UniProt: M4U3H1
Position
complement(1148921..1150963)
Genome map
AA seq 680 aa AA seqDB search
MQNQDRKILVTCALPYANGPIHLGHMLEHVQADIWVRFQRLRGNNVSFICADDAHGTPIM
LKANAMGITPEQMISEIKALHIKDFNDFDISFDNYHSTHSEENKTLSTHIYNTLHKNGFI
KTKTIEQLFDPEKEMFLPDRFVKGTCPKCKSEDQYGDNCDSCGATYSPTEMINPKSAVSG
ATPIMKETEHFFFDLPQFEDMLKTWTRSGALQIEMANKVAEWFEFGLKQWDITRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDRRDDLDFDEYWNKNSSTELYHFIGKDIVNF
HSLFWPAVLEGSGFRKPTAVHVHGYVTVNGAKMSKSKGTFIKASTYLEHLDPECLRYYYA
AKLTSKIDDLDLNLDDFMQRVNSDVVNKLVNLASRTAGFIAKKYNGELSVKIAEPALYQE
FIDAGESIASLFEKREFARAIREIMALADKANKYIDEKAPWALAKEADKDIEVQEICSMG
INLFRVLMTYLKPVMPKLTARSEEFLAETLDWEVIKTPLSGHKINKFKALFQRIDIKKVD
AMVDASKENIEIAAVAKVDESAQSELEKEPLCAEIDFDTFAKVDLRVARIIKAEHVPKAN
KLLKLTLDLGTETRTVFSGIKSACNPEDLEGKLTVMVANLKPRQMKFGLSEGMVLAAGPG
GKDIYLLTPDDGAQPGQRII
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaagatcgtaaaatccttgtgacctgcgccctcccctacgcgaatggtccc
attcatttagggcatatgttagagcatgtccaagcagatatctgggttcgttttcagcgt
ttacgtggcaataacgtaagttttatctgtgctgatgatgcacatggcacaccgatcatg
cttaaagccaatgcaatgggcattacaccagagcaaatgatcagtgagatcaaagcatta
cacattaaagattttaatgattttgatattagttttgataattatcattccacacactct
gaagaaaataaaacgctttccactcatatttataatacattgcataaaaatggttttatt
aaaacaaaaacgattgagcaacttttcgatcctgaaaaagagatgtttttaccggatcgc
tttgtaaaaggcacctgccctaaatgtaaatctgaagatcaatacggtgataactgtgac
agttgtggcgcaacatatagccccactgaaatgatcaaccctaaatcggctgtttcaggt
gcaacaccgataatgaaagaaacagagcattttttcttcgacttaccacaatttgaagac
atgctaaaaacatggacacgctctggagctctccaaattgaaatggcgaataaagtcgca
gaatggtttgaatttggtttaaaacaatgggatatcactcgcgatgccccatactttggt
tttgagatcccaaatgcaccgggtaaatatttttatgtttggctagatgcgccgattggt
tacatgggaagctttaaaaatctttgtgatcgccgtgatgatctggactttgatgaatac
tggaacaaaaacagtagcactgagttgtaccactttatcggtaaagatatcgtcaatttc
cacagcctattttggcctgcagtgcttgaaggcagtggctttagaaaacctaccgccgtt
cacgtacatggttatgtcacggtcaacggtgcaaaaatgtcaaaatctaaaggcaccttt
attaaagctagcacctatcttgagcatttagatcctgaatgcctacgttattattatgca
gctaaattaaccagtaaaattgatgatttagacttaaatttagatgactttatgcaacgc
gtaaattctgatgtggtcaataaattagtaaacttagcctcacgtacagcaggcttcatc
gctaaaaaatacaacggtgagctatctgtcaaaattgcagagcccgcattgtatcaagag
tttattgatgctggcgagtctattgcctctctctttgaaaaacgagagtttgcacgcgct
attcgtgagatcatggcattagctgacaaagcgaataaatatattgatgagaaagcacct
tgggcattggcaaaagaggcagataaagacattgaagtgcaagaaatatgctctatgggt
attaacttgttccgcgttctaatgacttatttaaaacctgtcatgccaaaattgaccgct
cgtagtgaagagtttttggcagaaacgctagattgggaagtgattaaaacaccactttct
ggccataaaatcaataaattcaaagcccttttccagcgcatcgacatcaaaaaagtagac
gcgatggtagacgcctctaaagaaaacattgaaatagcggccgttgctaaagtagatgag
agcgcacaatctgagttagaaaaagagcctttatgtgctgagattgattttgataccttt
gctaaagtcgatttacgcgttgcccgcatcattaaagcggagcacgtaccgaaggcgaat
aaattactgaaacttactttagatttaggcactgaaacgcgtactgttttttcaggtatc
aaatcagcatgtaaccctgaagatttagaaggaaaactgacagtcatggttgccaaccta
aaaccacgccaaatgaaatttggtttatctgaaggcatggtactcgcagcaggtcccggc
ggtaaagacatctatttattaacacctgatgatggcgcgcaacccggacaacgtattatc
taa

DBGET integrated database retrieval system