KEGG   Psychrobacter sp. AntiMn-1: AOT82_133Help
Entry
AOT82_133         CDS       T04964                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00071  Fatty acid degradation
psya00072  Synthesis and degradation of ketone bodies
psya00280  Valine, leucine and isoleucine degradation
psya00310  Lysine degradation
psya00362  Benzoate degradation
psya00380  Tryptophan metabolism
psya00620  Pyruvate metabolism
psya00630  Glyoxylate and dicarboxylate metabolism
psya00640  Propanoate metabolism
psya00650  Butanoate metabolism
psya00900  Terpenoid backbone biosynthesis
psya01100  Metabolic pathways
psya01110  Biosynthesis of secondary metabolites
psya01120  Microbial metabolism in diverse environments
psya01130  Biosynthesis of antibiotics
psya01200  Carbon metabolism
psya01212  Fatty acid metabolism
psya02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT82_133
   00630 Glyoxylate and dicarboxylate metabolism
    AOT82_133
   00640 Propanoate metabolism
    AOT82_133
   00650 Butanoate metabolism
    AOT82_133
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT82_133
   00072 Synthesis and degradation of ketone bodies
    AOT82_133
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT82_133
   00310 Lysine degradation
    AOT82_133
   00380 Tryptophan metabolism
    AOT82_133
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOT82_133
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT82_133
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOT82_133
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psya04147]
    AOT82_133
Enzymes [BR:psya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOT82_133
Exosome [BR:psya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOT82_133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin CDC45
Motif
Other DBs
NCBI-ProteinID: AOY42512
UniProt: A0A1D9CVF7
Position
complement(155485..157113)
Genome map
AA seq 542 aa AA seqDB search
MSNKNNHPDSPVVESTVVKASDAKPQEIAENNEPAKTADVKADTKANDTKADSTQADNTK
KEAPATKKSDAKGTDTNDSETKNTTSKQPDDEKVETTAAKKPATATKKASTTKPATNQNR
VAILGGNRIPFARSNGSYADVSNTDMLTAALDGLVERYNLQDEVIGEVVAGAVMKLSRDI
NLTREATLNTALNPHTPAYDISQACGTGLQATFASANKIALGIIDSAITGGVDTTSDAPI
AIGDGLRKVLIKLGAAKDNKQRLKALMGLNPKDLIDSPQNGEPRTGLSMGEHQAITTLEW
NITREAQDELAFNSHKNLARAYDEGFFDDLITPYKGLTRDNNLRPDTTLEKLGKLKPVFG
KKNANPTMTAANSTPLTDGASCVLLGTDEWAKEHGLKPLAYIVHQETAAVDFIGKSGTTE
GLLMAPAYAVPRMLERAGLTLQDFDFYEIHEAFASQVLSTLAAWEDETFCEERLGLDAPL
GSIDRSKLNVNGSSLAAGHPFAATGGRILATAAKLLDQKGSGRALISICAAGGQGVTCIL
EK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaaataaccaccctgatagtccagttgtcgaaagcactgttgttaaagcc
agcgatgcaaaaccacaagaaattgctgaaaacaatgaacctgctaaaactgctgacgtt
aaagctgatactaaggccaacgataccaaggctgatagcacacaagctgacaacacaaaa
aaagaagcgccagctactaaaaaatctgacgctaaaggaactgataccaacgactcagag
actaaaaataccactagcaaacaaccagatgatgaaaaagtagaaaccacagcagctaaa
aaaccagcgactgcaactaaaaaagcgagtacaaccaaacctgctacaaaccagaatcgt
gtggcaatcttaggtggtaaccgtattccatttgctcgctcaaatggctcatacgctgac
gtcagcaatacagatatgttgactgcggctctagacggcttggttgagcgctacaactta
caagacgaagtcatcggcgaagtggtcgctggtgccgttatgaagctaagccgcgatatc
aacctgactcgcgaagcaacattgaacacagcgctgaacccacacacaccagcctatgat
atctcacaagcgtgcggaactggcctacaagcgacctttgcttctgcgaacaaaatcgca
ctgggtattatcgattcagccattacaggcggcgtagatactacctcagatgcgcctatc
gctattggtgatggtctgcgtaaagtactgatcaagcttggtgccgccaaagacaacaag
caacgcctaaaggcattgatgggtctaaatccaaaagacttgattgactcaccgcaaaat
ggcgagccgcgcactggtctatcgatgggcgagcaccaagccatcaccacgcttgagtgg
aacatcactcgtgaagctcaagacgagcttgcctttaacagtcacaaaaacctagcacgc
gcttatgacgaaggtttctttgatgacttgatcaccccatacaaaggtctgactcgtgat
aacaacttacgtccagacaccacgctagagaaactgggtaagctaaagccagtatttggc
aaaaagaacgccaatccaacgatgactgctgctaactcaacgccactgactgatggcgca
tcttgtgtcctattgggtactgatgaatgggcaaaagagcatggtctaaaaccactggct
tatatcgtgcaccaagagacagcagcggtagactttatcggtaaatctggtactaccgaa
ggcttactcatggcacccgcttatgcggtaccgcgtatgcttgagcgcgctggcctcacg
ctacaagactttgatttctatgagattcatgaagcgtttgcctcacaagtgctatcgaca
ctcgccgcttgggaagatgagacattctgtgaagagcgcctaggtcttgatgcgccacta
ggctcgatcgatcgcagcaagctaaacgtgaatggctcatcgctagcagcaggccatcca
tttgccgcgaccggtggtcgtatcctagccaccgccgcaaaactacttgaccaaaaaggc
tcaggccgtgcgctaatctctatctgcgcagccggtggtcaaggcgtgacttgcatctta
gaaaaataa

DBGET integrated database retrieval system