KEGG   Psychrobacter sp. AntiMn-1: AOT82_1445Help
Entry
AOT82_1445        CDS       T04964                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00020  Citrate cycle (TCA cycle)
psya00480  Glutathione metabolism
psya01100  Metabolic pathways
psya01110  Biosynthesis of secondary metabolites
psya01120  Microbial metabolism in diverse environments
psya01200  Carbon metabolism
psya01210  2-Oxocarboxylic acid metabolism
psya01230  Biosynthesis of amino acids
Module
psya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psya_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT82_1445
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AOT82_1445
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AOT82_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOY43824
UniProt: A0A1D9CZ26
Position
complement(1619081..1620340)
Genome map
AA seq 419 aa AA seqDB search
MSYDKVIVPRDGEKVTVNADLSLNVPNHPIIPFIEGDGIGVDITPVMIKVVNAAVDKAYH
GKKSIIWMEAYLGEKAAKIYDGEYLPSETLEILKDYVISIKGPLTTPVGGGFSSLNVAVR
QNLDLYVCQRPVRWFKGVPSPVQHPELTNMVIFRENTEDIYTGIEWKAGSDDAKKVINFL
REEMGVTSIRFPEDCGIGIKPVSKEGSQRLVRKAIQHAIDNDLPNVTLVHKGNIMKFTEG
AFKDWGYELAAERFDAKPLDGGPWMTMKNPKTGNDIIIKDVIADAFLQQILMRPADYSVV
ATLNLNGDYISDALAAEVGGIGIAPGANKGGAIAVYEATHGTAPKYAGQNKVNPGSLILS
AEMMLRDMGWCEAADLIISGIQGAIANKTVTYDFERLMPDAILLSTSEFGKAIIKHMDA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatgataaggtcatcgtaccaagagacggcgaaaaagtaaccgtgaatgctgat
ttgtcgctaaatgtgcccaatcatccgattattccgttcattgaaggtgacggtattggg
gtggatatcacacctgtcatgataaaggtggtcaatgcagcggtcgataaagcctaccac
ggtaaaaaatcaattatctggatggaagcttacttgggcgaaaaagcggccaaaatatat
gacggtgaatatttacccagtgagacattagagattttaaaagactacgtcatcagtatc
aagggaccgttgaccacgccggtgggtggtggctttagttcgttgaatgtggctgtacgt
caaaatcttgatctgtatgtctgtcagcgaccagtacgctggtttaaaggcgtgccaagc
ccagtacagcatcctgagctgaccaatatggtgatctttcgtgaaaatacagaagatatc
tatacaggtatcgagtggaaggcaggcagtgatgatgccaaaaaagtcatcaatttctta
agagaagagatgggtgtgaccagcattcgcttccctgaagactgcggcatcggtatcaag
cctgtctcaaaagaaggctcgcagcgcctagtacgtaaagccattcagcatgctatcgat
aatgacttgccaaacgtgaccctcgtgcataaaggcaatatcatgaaatttacggaaggc
gcgtttaaagattgggggtatgagctggcagcagagcgttttgatgctaagccattagat
ggtggtccatggatgacgatgaaaaatcccaaaacgggtaatgacatcatcatcaaagat
gtgatcgctgatgcattcttgcagcagattttgatgcgtccggcagattactccgtagtg
gcaacactcaacctgaacggtgactatatctctgacgcgctagcggcggaagtaggcggt
atcggtattgccccaggtgccaacaaaggcggcgcaatcgctgtctatgaagcgacgcac
ggtactgcgcctaagtatgctggtcagaataaagtaaacccaggctcattgatattgtct
gcggaaatgatgctgcgtgatatgggttggtgtgaggcggcggatctcatcatcagtggt
atccaaggcgcgatcgccaataagacggttacttatgactttgagcgtttgatgccagat
gctatcttgctcagtacttctgagtttggcaaagccattatcaagcacatggatgcgtaa

DBGET integrated database retrieval system