KEGG   Psychrobacter sp. AntiMn-1: AOT82_1550Help
Entry
AOT82_1550        CDS       T04964                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00430  Taurine and hypotaurine metabolism
psya00620  Pyruvate metabolism
psya00640  Propanoate metabolism
psya00680  Methane metabolism
psya01100  Metabolic pathways
psya01120  Microbial metabolism in diverse environments
psya01200  Carbon metabolism
Module
psya_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT82_1550
   00640 Propanoate metabolism
    AOT82_1550
  09102 Energy metabolism
   00680 Methane metabolism
    AOT82_1550
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AOT82_1550
Enzymes [BR:psya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AOT82_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AOY43929
UniProt: A0A1D9CZC5
Position
1741636..1742868
Genome map
AA seq 410 aa AA seqDB search
MSDSLTTTFDDKNSETSTLTSPTLVLNCGSSSIKYALISDDNSTRITGLAENLGLDTARI
KHTTLNGEKLEISIPGGRHKLALQKILELLEQYHFIAVGHRVVHGGREYSKAVRVDEHAL
EEVKRLKILAPLHNPANALGIEAVQAIYPDMPQVVVFDTAFHQTMPPVAFRYALPKYLYE
EHKIRRYGFHGTSHAYVSERTSQITDAKGPHGWLTAHLGNGCSTAAVYDGKSLDTSMGLT
PLEGLMMGTRSGDVDPSLHMHLKRQLGMSLEETDKMLNNDSGLLGISGLSNDLRTIEQAA
SEGHEDAKLAIEMFCYRAGKYLASLSCALPEFTGIVFTGGIGENSNITRTKILAVMRHFG
IKIDADKNASLVRGKEGSFHADDSSIELWVVPTDEECRIAQETRQALNLI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcctaaccaccacttttgatgataagaactctgaaacatcaaccctgacc
agcccaaccttggttttaaactgcggctcgtcttccatcaaatacgcgttgattagtgat
gacaactctactcgtatcaccggtcttgccgaaaacctaggtctcgataccgcccgtatt
aagcacacgaccttaaacggtgaaaaacttgaaatctctattcctggtggtcgccataag
ctggcgctacaaaaaatccttgagctactagagcagtaccacttcatcgccgttgggcac
cgcgtggtacatggtggccgcgaatattccaaagccgttcgcgttgatgagcatgcgtta
gaagaagtgaagcgtctcaaaatattagctccgctacacaaccctgcaaacgcactgggt
atcgaagcggttcaggcgatctatcctgatatgccgcaagtggtggtgtttgacaccgct
tttcaccaaaccatgccgcccgttgcttttcgctatgcgctacccaaatatctatacgaa
gagcataaaatccgtcgctatggcttccatggcacatcacatgcttacgtctcagaacgc
accagccaaatcactgacgcaaaaggcccgcatggctggctaacagcacatctaggcaat
ggttgctcaaccgccgcagtatacgatggcaaaagtctcgataccagcatgggtctgacc
ccacttgagggccttatgatgggtacgcgtagtggcgatgtggatcctagcttgcacatg
cacctgaagcgtcagctcggtatgagcttagaagaaaccgacaaaatgcttaataatgac
agcggtctacttggtatctcaggactgtctaacgacttgcgtaccatcgagcaagcagcc
agtgaaggtcacgaagatgccaagctcgctatcgagatgttctgctatcgtgctggtaaa
tatctggccagccttagctgtgcgctaccagagtttaccggtattgtctttactggcggt
atcggtgagaactccaacattacacgtaccaaaatcctggcagtgatgcgtcatttcggt
atcaaaatagatgctgacaaaaatgccagtttggttcgtggtaaagaaggcagcttccac
gcagatgacagcagtatcgagttatgggtcgtcccaactgatgaagagtgccgtattgct
caagagactcgtcaggcattgaatttaatataa

DBGET integrated database retrieval system