KEGG   Psychrobacter sp. AntiMn-1: AOT82_2254Help
Entry
AOT82_2254        CDS       T04964                                 

Definition
(GenBank) phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00770  Pantothenate and CoA biosynthesis
psya01100  Metabolic pathways
Module
psya_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AOT82_2254
Enzymes [BR:psya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AOT82_2254
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     AOT82_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein WT1 DUF2946
Motif
Other DBs
NCBI-ProteinID: AOY44633
UniProt: A0A1D9D1G7
Position
2515410..2516807
Genome map
AA seq 465 aa AA seqDB search
MSNIVLAITGGIAAYKSAIFARLLIKAGFDVRVIMTTGAQAFITPLTLQALTGNEVHVSL
LDEQAEAGMGHIELAKWADLIVIAPASANTLARLAMGMADDLLTTVCLATTAPVIIAPAM
NQQMWAHPAVNLNVQTLRDMNYQIIQPASGEQACGDVGAGRLPEPEQLLAEVLLFKAMNT
TPQLLAGKRVVITAGPTVEAIDPVRYLSNHSSGKMGFALARACVAAGAEVILIAGGKVAL
PTPLNVTRIDVLSAKDMLIAAQQCVDGTHSELQLDLEDEYDHSHEHAHEHAHEHSHSHTH
EHHHSDCGCGDEHELPQAYTEHQFVKADIFIATAAVADYRTIDAAPQKIKKTQDAMNLSL
VKNPDILATISLAHPELFVVGFAAETQDVERYARGKLAAKALDMIACNDVSRADIGFASD
DNAMQVFFSERYERDAITLDKASKDKIAEQLASIIGETIAQRQNS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatattgtgcttgctattactggcggtatcgccgcttataaatctgctatattt
gcccgcttgttgattaaagcaggctttgatgtgcgcgtcattatgacgacaggcgcacaa
gcatttatcacaccgctgactctgcaagcgttgacgggtaacgaggtgcatgtctcatta
ctcgatgagcaggcagaagcggggatggggcacattgagctggctaaatgggcggactta
attgtcattgcccctgcgtccgccaatacgctcgcacgtctggctatgggaatggctgat
gatttgttgaccacagtgtgccttgccacaaccgcaccagttattatcgctcctgcgatg
aatcagcagatgtgggcgcatcctgcggtaaatctgaatgtacaaaccctgcgtgatatg
aactatcagattatccagccagccagcggtgagcaagcgtgtggtgacgtgggtgcaggg
cggctgcctgagcctgagcagttgttggctgaggtactcttgttcaaagcaatgaacacg
acgccgcaattattagcaggcaaaagagtggtcattaccgcaggacctacagtagaagca
atcgatcctgtgcgctatttgtccaatcattcttcaggaaaaatgggctttgctttagcg
cgcgcttgcgtggcggctggcgcagaggtgatcctaatcgctggtggtaaagtggcattg
cccacgccgcttaatgtcacacgaattgatgtgctgtctgccaaagatatgctgatcgct
gcccagcaatgtgtggatggtacgcatagcgagcttcaattggatcttgaagatgagtat
gaccattctcatgagcacgcacatgaacacgcacatgaacatagtcattctcacactcat
gagcaccatcatagcgattgtggttgcggtgatgagcatgaactaccgcaggcttatact
gaacaccaattcgtaaaggcagatatctttatcgcgaccgccgcagtagcagattatcgt
accatcgatgccgccccgcaaaaaattaaaaagacacaagatgctatgaatctcagcttg
gttaaaaaccctgatattttagcgacgatttctcttgctcatccagaactgtttgtcgtt
ggttttgccgcagaaacacaggatgtcgagcgttatgcgcgtggtaagctagctgcaaaa
gcgctagatatgattgcctgtaacgatgtctcacgggcagatattggttttgctagtgac
gataatgccatgcaggtatttttctctgagcgctatgagcgtgatgcgataacgttagac
aaagccagcaaagacaagatcgctgagcagttagccagtattattggtgaaacaatcgct
caacgtcaaaacagctag

DBGET integrated database retrieval system