KEGG   Psychrobacter sp. AntiMn-1: AOT82_30Help
Entry
AOT82_30          CDS       T04964                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00450  Selenocompound metabolism
psya00970  Aminoacyl-tRNA biosynthesis
psya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AOT82_30
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AOT82_30
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psya01007]
    AOT82_30
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psya03016]
    AOT82_30
Enzymes [BR:psya01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AOT82_30
Amino acid related enzymes [BR:psya01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AOT82_30
Transfer RNA biogenesis [BR:psya03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AOT82_30
 Prokaryotic type
   Other AARSs
    AOT82_30
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF4413
Motif
Other DBs
NCBI-ProteinID: AOY42409
UniProt: A0A1D9CV32
Position
complement(33742..35841)
Genome map
AA seq 699 aa AA seqDB search
MREILVTSALPYANGDIHLGHLVEYIQTDIWVRAMKAQGHQVTYVCADDAHGTAIMLKAE
ANGVTPEEQIASVKASHEADFSKFLINFDNYHSTHSEENKQFSELIYRRLNEAGHISTKD
VEQLFDPEKQLFLADRFVKGTCPECDSPDQYGDNCEVCGTTYDATELKNPRSTLSDATPV
LKTSKHYFFDLPEFEQFLQDWTRSDNRLQTSVANKLQEWFEAGLTSWDISRDAPYFGFQI
PDTPSDEPDKYFYVWLDAPVGYMASFKNLCDKRAGTEQALDFDRYWAQENEHKTEVYHFI
GKDIVYFHALFWPAMLAGSELRTPTGVFAHGFLMVNGEKMSKSRGTFIKAETYAEHLHPE
YLRYYFASKLSDKVEDINLDLEDFMQKVNSDLVGKVVNIASRSAGFLVKKYDGILSETCA
EPRLLEDITKTGDEIAAAYENREFSRAMRLIMQCADKANEYIDAKKPWSLAKLEGTEQEV
QDVCSVAINIFRQLMVYLAPVLPELTANAKEFLNIDDLSFASRNEWLLGHKINKFKPLMQ
RIEEKDIEAMVEDSKASLAQADAPAVTENNKPAAKDKSPAIDANTVAEQTDYIGIEDFAK
VEMKVAKVLECNHVEGADKLLQFTLDVGEEKPRNVFSGIRKFYEPEQLTGKKVICVTNLA
PRKMKFGISEGMILSSGDPKTQLTVVTLPDNCVIGDVLA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagattttagtaaccagtgcgctgccctacgccaatggcgacatccatttgggg
catcttgtagaatatattcagacagacatctgggtacgtgcgatgaaggcgcaaggccat
caggtcacttatgtctgtgccgatgacgcgcacggtacagccatcatgctcaaagcagaa
gccaatggcgtcacgccagaggagcaaattgcctcagtcaaagcctcacacgaagcagat
ttttcaaagttcctgatcaattttgataactaccacagcactcattcagaagaaaacaaa
cagttctctgagctgatttatcgtcgtctcaatgaggctggtcatatcagcacaaaagat
gtcgagcagctatttgatcctgaaaagcaattgtttttagccgatcgttttgtcaaaggc
acttgccctgagtgcgattcaccagatcaatatggtgataactgcgaagtatgcggcacc
acttatgatgccactgagctgaaaaacccgcgctcaacgttatcggatgccacgcctgtg
cttaaaacttctaagcattatttctttgacttgccagagtttgagcagttcttacaggac
tggacgcgcagtgacaatcgcttgcaaacctcagtggctaataaattgcaagaatggttt
gaggcaggacttactagctgggatatctcgcgcgatgcgccctacttcggttttcaaatt
ccagacaccccaagcgatgagccagacaaatatttttatgtctggcttgatgcgccagtt
ggctacatggcaagctttaaaaacctatgtgataagcgtgcgggaacagagcaagcgctt
gattttgaccgctactgggcacaagaaaacgagcacaaaaccgaagtttatcacttcatc
ggtaaagacatcgtgtatttccatgcactgttttggccagccatgctagccggtagcgaa
ttgcgcacgccaacgggcgtctttgcccatggcttcttgatggtcaatggcgaaaaaatg
agtaagtcacgcggcactttcatcaaggccgagacgtatgctgagcatttacaccctgaa
tacttacgttattacttcgccagcaaactgtctgacaaagtcgaagatatcaaccttgat
ttagaagactttatgcaaaaggtcaactctgacttggtgggtaaagtggtcaatatcgct
agtcgtagtgcaggattcttggttaaaaagtacgacggtatactgtctgagacttgcgct
gaaccgcgcctattagaagacattaccaaaacgggcgatgagattgctgctgcttacgag
aatcgtgaattctcacgtgctatgcgcctcatcatgcagtgtgcggataaagccaacgaa
tatatcgatgccaaaaaaccatggtcgctcgcgaaattggaaggcactgagcaagaagtt
caagacgtctgctcggtcgctatcaacattttccgtcagttgatggtctatctggcacca
gtattgcctgagctgacagcaaatgcgaaagagtttttgaatattgacgatttaagcttt
gccagtcgtaatgagtggttattaggccataaaatcaataaattcaagccactgatgcaa
cgtatcgaagaaaaagatattgaagccatggtagaagattctaaagcatcattagctcaa
gctgatgcgcctgctgtgaccgaaaataacaagcctgccgcaaaagacaaatcacctgca
atagacgctaatactgttgccgagcaaacggattatattggtattgaagactttgctaag
gttgagatgaaagtcgctaaagtgcttgagtgcaatcacgtagaaggcgcggacaagctg
ctacagttcacactagatgttggtgaagaaaagccacgtaacgtgtttagcggcattcgt
aagttctatgagcctgagcaactgacgggtaagaaagtcatttgcgtgaccaaccttgcc
ccgcgaaagatgaaatttggtatctctgagggcatgattttgtcatcaggcgatccaaaa
actcagctaacggtcgttacgctacctgataactgtgtcattggtgatgtactcgcataa

DBGET integrated database retrieval system