KEGG   Psychrobacter sp. AntiMn-1: AOT82_386Help
Entry
AOT82_386         CDS       T04964                                 

Definition
(GenBank) exonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psya00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOT82_386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psya03400]
    AOT82_386
Enzymes [BR:psya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AOT82_386
DNA repair and recombination proteins [BR:psya03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOT82_386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_11 DUF5638 RepL
Motif
Other DBs
NCBI-ProteinID: AOY42765
UniProt: A0A1D9CW25
Position
442057..446583
Genome map
AA seq 1508 aa AA seqDB search
MTDFTDTTDIIEPTVQPNLSDDHPDVSGDSGAIVEEKEEVTPAVAVALTGRHLIEASAGT
GKTWTLTGIVLRLLIEVRRAPEQIIATTFTRAAAAEMRQRIHDRLVEFYQLLQWVNNLSA
DTKNKDNLYPNILQVLPDRGDNKNNKDKPTSNDSSIESNAKTEADEFNQDIDHDHKHAQQ
VAREKRAQVKKAREDWLKEQAKHARLNAIMDDPINLHLVGYLLDHVYSYPMAEAIRRTAL
VLTTLDKLFVGTLDSLAQKWLTEYSSETGHQQGMAIIEDSSIEQVTDSIIHDELRQFQSR
LYHEQPKLYALMDQQGKLTAVGDHKNFVSRSLNFISAPIDEIKLEQGFDFDAYEKLIDEF
AQLDLADIQPYLNPDYRKSQGFRGNSNLTNHFDALVDVHQKVVQYQLTFSSYLNERENKI
LTSLQDARYPNEDGKIKNFNKNREKEHQTLFELETISTLMALLDMIERLNQYILLILANL
NRHIVLAVRNRLPVILEERGETTFSLQMVRLNQALTGRQGDKLARYIRHHYPIALIDESQ
DINGEQAIMIESIYLPKRKRKQSDNDKQSTTKKSSHEFLLLVGDPKQAIYGFRGGDVTNY
NYMKGQFDKSTIWTLNTNRRSNAGVIHALNCWFGMPTATTADNKLAQLGSDIYYQHTKAR
KEKEGEEAKSKLSWFRDSDAKDSSLVTEVLSAQPVSILHLPNGKDGELDYDEYEITARHI
ASLLSSGQTLKDRPIQPSDIGVLARTKKDLKQVEDELVKLGVPTLTTSDVSIFETIMAED
VAALLSAMLYPYRHDMINRVLTSHLYGLSINDIKAMMTDHESGVAESDDRLNSINLNSSD
VQNTEHKKSYQDFITYLKEGAQRWQHFGVLSALHYLLDKSPIQTQGVWQALAAHPDGDRH
IMDLRHIMDVLAQYGLGMGEHELLAWFRQHIEAAPNSDWAKQYPLPTESGVQLMTIHKSK
GLEFPIVYVLGMGDASRKSGNNEKYGLYLYNAQQAPSALVQQSAKDQFIGNQRRFSPLQG
SATVEDYYTDIETKEGFDELRRLGYVAFTRASEQLYIVLRDPSNKTGFELKPVFYWFDSP
DAKFELPDRLKGTIGMLRGHNINEFYNSHYTKTVTSTDTKLTIEPTTQAIEYVPFAEVMK
TSYFYGWAKTSFTALARQLDESTQAMAVVDERIDDAIDIDMADAAMSLEPYPNSSLDSNT
SLEKIDELSLKSEEDIRFTFVKGANAGTFLHEIFEKIDFTNKSQWSGVIDRAVSSYQLPL
MYSSAEHQSRRAQGNREESSVSFNADAIDTTKHEALIAWIEEVLRTPLLASNQPLYSLNE
EQRFAELEFNMGLSERFKAEDISQLFQQYLPDETDKHVNLVPQNRTHLYRYLRGEIDLVY
EYAGKYYVVDYKSNFLGNSLSDYNENTLRKAMTKAGYWLQAAIYQVALHRFLSMRIADYV
GNESRYLGAVEYVFLRGVYSPDAQATATVSQEAIKTSESPHNGRYGLVTWDIPIDFIKGL
DALFGVPD
NT seq 4527 nt NT seq  +upstreamnt  +downstreamnt
atgacagattttactgacacaaccgacattatcgaacctactgtacaaccaaatttatct
gacgatcatccagatgtttcgggtgactcaggggctatagttgaggaaaaagaagaagta
acaccggcggttgctgttgcattaacgggaaggcatcttatcgaagcctcagcaggtaca
ggcaaaacgtggacgctgacaggcattgtgctgcgtctcctgattgaagtgaggcgtgcg
ccagagcaaatcattgccaccacctttactcgagccgccgctgccgagatgcgtcagcgt
atccatgatcgtttggtagagttttatcagctattacaatgggtcaataacctgagtgca
gataccaagaacaaagataacttatatcccaatatattgcaggtactgcctgataggggc
gataacaagaataacaaggataagccaacaagcaacgactcaagtatcgaatcaaatgct
aaaacagaggctgatgagtttaatcaagatattgaccatgaccataaacatgctcagcag
gtggctcgagaaaagcgcgcgcaagtcaaaaaagcgcgtgaagattggttaaaagagcaa
gccaaacatgcacgcttaaacgctattatggacgatcccattaacctacatttagtcggt
tatctattagatcatgtgtatagctatccgatggcggaggcgatccggcgtactgcatta
gtgttaaccacgttggataagctgtttgtcgggacgctcgatagcttggcgcaaaagtgg
ctgaccgagtacagtagtgaaaccggtcatcagcaaggcatggcgattatagaagacagt
agtatcgagcaggttaccgatagtattatccatgatgagctgcgtcagtttcaaagccgt
ttgtatcatgagcagcccaaactgtatgcgcttatggatcagcaaggtaagctgacagca
gtaggtgatcataaaaattttgtttctcgctcgctgaattttatttctgcgccgattgat
gagataaaactagagcaaggatttgattttgatgcgtatgagaaattgattgatgagttt
gcccagttagatttggcagatattcagccctatctaaaccccgattatagaaaatctcaa
gggtttcgtggaaactctaatttaaccaatcattttgatgctcttgtcgatgttcatcaa
aaagtagtccaatatcagctgacatttagcagctacttgaatgagcgtgaaaacaagata
ttgacgtctttgcaggatgccagatatccaaatgaagatggcaaaattaaaaactttaat
aagaatagggagaaagagcaccagaccctttttgagttagagaccattagtacattaatg
gcgctcttggatatgatcgaaaggttaaatcagtatattttattgattttagccaacctc
aaccgtcatatcgtgcttgcggtacgcaatagactgccagtgattttagaggagcgaggg
gagaccacctttagtctgcagatggtgcgcttaaaccaagcactaacaggtcggcaaggc
gataagctagcacgttatatacgtcaccattaccccattgcattaattgatgagtcgcaa
gatatcaatggcgagcaagccattatgatcgaaagtatctatttgccaaagcgtaaacgt
aaacagtcggataatgacaagcaatccactaccaaaaaatccagccatgagtttttgcta
ctggttggtgacccaaagcaggcgatctatgggttccgtggcggtgacgtgaccaactat
aattatatgaaagggcagtttgacaaaagtaccatttggacgctcaacaccaaccgtcgc
tcaaatgcaggggtgattcatgcactaaactgctggtttggtatgccgacagcaacgact
gctgacaacaagctggcacagttgggcagtgatatttattaccagcatacgaaagctagg
aaagaaaaagaaggtgaggaagccaagagtaaactatcttggtttagggattcagacgca
aaagatagtagcttggtgacggaagtgctttctgctcagccggtgagcatcttgcacctg
cctaatggtaaagatggtgagcttgattatgatgagtatgaaatcaccgctcgtcatatt
gctagcttgctcagtagtggtcagacattaaaagataggccgattcagcctagtgatatt
ggagtgttggcacgtaccaaaaaagatttaaagcaggttgaagacgagttggtcaaacta
ggcgtcccaaccctgaccaccagtgacgtcagtatcttcgagacgattatggcagaagat
gtcgcagcgctactgagcgccatgctctatccgtatcgtcatgacatgattaatcgggtc
ttaaccagtcatctatatggcctaagtatcaacgatatcaaagccatgatgacggatcat
gagtcaggcgtggctgagagtgacgatagacttaatagtatcaatctaaatagtagcgat
gttcaaaatacagaacataaaaagagctatcaagattttattacgtatctaaaggaaggg
gcacagcgctggcagcattttggtgttttgtcggcgctacattacttactagataaaagc
cccatacagacacaaggcgtttggcaagcactagccgctcatccagatggcgatcgacat
atcatggatttgcgtcatatcatggatgtgttggcgcagtatggcctaggcatgggtgag
catgagctattagcttggtttaggcagcacatagaggctgcacccaacagcgattgggcg
aagcagtatccgctacccacagagtctggcgtgcagctcatgaccattcataaatcaaaa
gggcttgagtttccgatagtctatgtactgggtatgggagatgccagtaggaaatcaggt
aataatgagaagtatggtctgtatctatataatgctcagcaagcaccttcagcgttagtg
cagcaatcagcaaaggatcaatttataggtaatcagcgccgcttctcaccattgcaaggc
tctgctacggtagaggactattatactgatatcgaaacaaaagaaggctttgatgagctg
cgccgacttggttatgtggcatttacgcgggctagcgagcagctttatatcgtgctgcga
gatccaagcaacaaaacaggatttgagctaaaaccggtattttattggtttgattctcca
gacgcaaagtttgaattacctgataggctaaaaggcacgataggtatgcttagaggtcat
aatattaatgagttctataatagtcactatactaagacagtaacgtcaacagataccaaa
cttaccatcgaacccacgacacaagcgattgagtatgttccttttgctgaggtcatgaaa
acgagttatttttatggttgggctaagaccagctttacagctttggctcgtcagctagac
gaatcaacacaagcaatggctgttgttgatgagcgtattgatgatgcgatagacattgat
atggcagacgctgcaatgtcgttagagccttatcctaatagtagccttgatagtaatacg
tctctcgaaaaaattgatgagctaagtctcaagtcagaagaggatattcgctttaccttt
gtaaaaggtgctaatgcaggtacgtttttacatgagatatttgaaaaaatcgatttcact
aataaatcccagtggtctggggtgatcgatagagcggtcagtagttatcaattaccgctg
atgtatagcagtgctgaacaccaaagccgtagagcacaaggtaaccgagaagagagttct
gtctcatttaacgctgatgcaatagatacgacaaagcatgaggccttgattgcttggatt
gaagaagtgctgcgtactccgctgctagcgtccaatcagccactttattctctcaacgaa
gagcaacgctttgctgaattagagttcaatatggggctgtcagagcgctttaaagcagag
gatatcagtcagttatttcaacagtatctacctgatgagacagacaagcatgtcaatctt
gtaccgcaaaatagaacgcacttgtatcgttacttgcgtggtgagattgatttggtttat
gagtatgctggcaagtactatgtggtcgattataagagtaattttttaggaaatagccta
agcgattacaatgaaaatacactcagaaaggctatgacaaaagcaggctactggctacaa
gcagcaatttatcaagtagctttgcatcgattcctttcgatgagaattgctgattatgta
ggcaatgagtctaggtatttaggggcggtagaatatgtctttctaagaggggtatatagc
cccgacgctcaagcaactgctaccgtatcacaagaggctattaagacgagcgaatcacca
cataacggccgttatggacttgtgacgtgggatataccaatcgattttatcaaaggttta
gatgcgctatttggtgtacctgattag

DBGET integrated database retrieval system