KEGG   Psychrobacter sp. AntiMn-1: AOT82_564Help
Entry
AOT82_564         CDS       T04964                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00540  Lipopolysaccharide biosynthesis
psya01100  Metabolic pathways
Module
psya_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AOT82_564
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psya01005]
    AOT82_564
Enzymes [BR:psya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     AOT82_564
Lipopolysaccharide biosynthesis proteins [BR:psya01005]
 Unusual sugar
  AOT82_564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD_2 Dimerisation
Motif
Other DBs
NCBI-ProteinID: AOY42943
UniProt: A0A1D9CWL4
Position
complement(649405..649971)
Genome map
AA seq 188 aa AA seqDB search
MQDLIKKAGQVKLLIMDVDGILSNGQIIYDANGIETKAFSVQDGVGVKSLARYGILTAII
TGRSSAMVDKRATEMGVNHVVQGRDDKLIALKELLSSLDPALNITAADCAYMGDDLPDIK
AMQTVGFAATVPNAHAEVIKRSDMVTTRAGGTGAVREVCDLILKGYGHYQDFIAHYTLDE
TQAQDELS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttaataaaaaaagccggacaagtaaagctattgatcatggatgtcgatggg
attttatctaatggtcaaattatctacgacgcaaatggtatcgaaaccaaagcgttttca
gtacaggatggcgtcggtgttaagtctctagcgcgttatggcattttaactgctattatt
actgggcgtagcagcgctatggttgataaacgtgcaacagaaatgggtgtcaatcatgtg
gtacaaggacgggatgataagctcattgcactaaaagagttattatcgtctcttgaccct
gcgctcaatattactgctgccgactgcgcttatatgggtgatgacttgccagatattaaa
gcgatgcaaacggtagggtttgcagcaaccgtacccaatgcacacgcggaagtcataaaa
cgcagtgatatggtcaccactcgagcaggtggtaccggcgcagtacgtgaagtatgtgat
ctcatcttaaaggggtacggacattatcaagactttattgcacattatacgcttgatgaa
actcaagctcaggatgaactgtcgtga

DBGET integrated database retrieval system