KEGG   Psychrobacter sp. AntiMn-1: AOT82_722Help
Entry
AOT82_722         CDS       T04964                                 

Definition
(GenBank) small (beta) subunit of the fatty acid-oxidizing multienzyme complex
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00071  Fatty acid degradation
psya00072  Synthesis and degradation of ketone bodies
psya00280  Valine, leucine and isoleucine degradation
psya00310  Lysine degradation
psya00362  Benzoate degradation
psya00380  Tryptophan metabolism
psya00620  Pyruvate metabolism
psya00630  Glyoxylate and dicarboxylate metabolism
psya00640  Propanoate metabolism
psya00650  Butanoate metabolism
psya00900  Terpenoid backbone biosynthesis
psya01100  Metabolic pathways
psya01110  Biosynthesis of secondary metabolites
psya01120  Microbial metabolism in diverse environments
psya01130  Biosynthesis of antibiotics
psya01200  Carbon metabolism
psya01212  Fatty acid metabolism
psya02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOT82_722
   00630 Glyoxylate and dicarboxylate metabolism
    AOT82_722
   00640 Propanoate metabolism
    AOT82_722
   00650 Butanoate metabolism
    AOT82_722
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT82_722
   00072 Synthesis and degradation of ketone bodies
    AOT82_722
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT82_722
   00310 Lysine degradation
    AOT82_722
   00380 Tryptophan metabolism
    AOT82_722
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOT82_722
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT82_722
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOT82_722
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psya04147]
    AOT82_722
Enzymes [BR:psya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOT82_722
Exosome [BR:psya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOT82_722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOY43101
UniProt: A0A1D9CX19
Position
complement(835421..836629)
Genome map
AA seq 402 aa AA seqDB search
MTETAYIYDAIRTPRGKGKKDGALYQASPIWLTRTLLKEMEQRHNLDTSLVDDVVLGCVT
PVGEQGSDIARIAVIDAGWAQSVAGLTLSRFCASGLESINLAAAKIMSGMEDMVVAGGVE
SMSRVPMGSDGGAWYMDPRVNEATHFVPQGVGADTIATLKGFSRSDVDAFATESHRRAAK
AWENGYYDKSVVPVTDINGMMLLDKDETIRPNTNVETLAGLKPSFIMPGKMGFDSVILDR
YTTIETVSHVHHAGNSSGIVDGAAICLVGSAAAGQKAGLKPRAKITMASVIGSEPAIMLT
GPTPACQKALDKAGMQASDIDLWEINEAFAAVPMNTADDFGISLDIVNVNGGAIAMGHPL
GATGAMLMTTVLDELERRDLQTAMITLCVGGGMGIATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgagactgcttacatttatgatgctatccgcacgccacgcggcaaaggaaaaaag
gacggcgctttgtatcaggcgtcaccaatctggctgacacgtaccttattaaaggagatg
gagcagcgtcataacttggataccagtttggtcgatgatgtggtgcttggctgcgtgacc
ccagtgggcgagcaaggctctgatattgcgcgtatcgccgtcattgatgctggttgggca
caaagtgtggcaggtcttaccttgtctcgtttttgtgcctctggtctggagtctattaat
ctggcagcggccaagatcatgtcaggtatggaagacatggtagtggcaggcggtgtggag
tcaatgagccgcgtgccgatgggctctgatggcggtgcttggtacatggatccgcgtgtg
aatgaagcgacgcatttcgtaccgcaaggggtgggcgcggataccattgcaacgcttaaa
ggctttagccgtagcgatgtcgatgcttttgccactgaatcacatcgccgcgcagcaaag
gcttgggagaacggctattacgacaaatctgttgtccctgtcaccgatatcaatggcatg
atgctattggataaagacgaaaccatccgtcctaataccaatgtcgaaaccttagcgggt
cttaaaccttcttttattatgccgggaaaaatgggctttgatagtgtgatattagaccga
tacaccacgattgaaaccgtgagtcatgtgcatcatgcgggtaattcttctggcatcgtt
gatggggcggcgatttgtttggtcggtagcgcggcggctgggcaaaaagcaggactaaaa
ccacgcgccaaaatcacaatggcctcagtcattggttcagagcctgccattatgctgaca
ggtccaacgccagcttgccaaaaagccctcgataaagcgggcatgcaagcctctgacata
gacctttgggagattaatgaagcattcgctgctgtgccgatgaataccgctgatgatttt
ggaatctcgcttgatattgtcaacgtcaatggtggtgcaatcgctatgggtcatccgctt
ggggcaacgggcgcgatgctaatgacgacagtccttgatgagttggaacgccgcgactta
cagactgctatgattacgctatgtgtgggcggtggtatgggaattgccactattatcgag
cgtgtttaa

DBGET integrated database retrieval system